Gamma-GT-analyse i diagnosen leversykdommer

Gamma-glutamyltranspeptidase (GGT) finnes i de største mengdene i nyrer, lever, bukspyttkjertel og tarmer. Enzymet er lokalisert i cellemembranen. Studien av gamma-GT lar deg evaluere sykdommer i leveren og galleveiene. I omtrent 70% av tilfellene viser resultatene av analysen kronisk alkoholisme, samt overvåker overholdelse av alkoholuttak under terapi. Mengden i celler kan øke under påvirkning av forskjellige medikamenter (fenytoin, barbiturater, østrogener) og alkohol (spesielt konsumert regelmessig). Under påvirkning av de listede stoffene kan antall gamma-HT-overføringer fra celler til blodet øke..

Biokjemisk analyse

Konsentrasjonen av gamma-GT informerer oss om leveren, nyrene, bukspyttkjertelen og prostatakjertelen. Finn ut hvilke GGT-standarder som finnes.

Biokjemisk analyse av GGT blir utført i diagnosen sykdommer i lever og galleveier. Resultatene av studien avhenger av flere faktorer. Vurder normene og avvikene.

Normen for kvinner er 10-66 U / L, og for menn - 18-100 U / L. Økte GGT-nivåer - fra 120 til 1000 U / L.

Hvis testresultatene avviker fra normen

Det skal bemerkes at verdiene som aksepteres som normen for GGT i forskjellige laboratorier og forskjellige litteraturkilder kan variere veldig, til og med flere ganger. I denne forbindelse er det nødvendig å sammenligne ditt eget resultat med normene til laboratoriet der du donerte blod for analyse. Gamma-GT øker i blodet med sykdommer i forskjellige organer og systemer: lever, nyre, lunger og bukspyttkjertel.

Leversykdom

En økning i aktiviteten til dette enzymet kan føre til et bredt spekter av leversykdommer. Disse inkluderer:

1. Alkoholisk leversykdom. En økning i nivået av enzymet observeres, gamma-HT økes 10 ganger fra den øvre grensen av normen. Å stoppe alkohol synker ikke stoffet nivået automatisk og raskt. Det tar omtrent 4 uker før enzymnivåene går ned til normalområdet..

2. Blokkering av sekresjon av galle eller galleveier (kolestase). Også i dette tilfellet dominerer en økning i gamma-GT-aktivitet blant biokjemiske forandringer (spesielt ved ekstrahepatisk kolestase). Kanskje til og med mer enn ti ganger kan det overstige normen. Galle produseres av levercellene, kommer først inn i galleblæren og deretter inn i tarmen. Blokkering av utstrømning (eller utskillelse av celler) kan ha forskjellige årsaker:

  • sykdom i fordøyelsessystemet;
  • gallestein;
  • skrumplever i leveren;
  • galleblæresykdom;
  • bruk av visse medisiner;
  • tumorer;
  • cyster;
  • infeksjoner.

Et typisk symptom på kolestase er en betydelig økning i blodaktiviteten til alkalisk fosfatase (ALP), samt bilirubinkonsentrasjon.

3. Alkoholfri steatose i leveren. I dette tilfellet, som regel, er veksten av gamma-GT relativt mykere (2-3 ganger mer enn de øvre grensene for normen). De mest utsatte er personer med overvekt, diabetes mellitus type 2 og hyperlipidemi. Dette kan føre til fibrose og skrumplever i leveren..

4. Hepatitt C er ofte manifestert gjennom virus: HAV, HBV, HCV. Mengden gamma-GT i serum kan øke med betennelse i leveren. Ved akutt hepatitt observeres imidlertid først og fremst en stor økning i aminotransferase-aktivitet..

5. Skrumplever i leveren. I tillegg til å øke aktiviteten til gamma-GT, kan denne sykdommen manifestere seg med et økt nivå av ammoniakk, bilirubin, alkalisk fosfatase, noen ganger med et økt protrombin og et redusert nivå av albumin. Det er verdt å huske at i tilfelle av skrumplever er aktiviteten til aminotransferaser ofte innenfor normale grenser..

6. Svulster i leveren kan forårsake en betydelig (flere ganger høyere enn øvre normalgrense) økning i gamma-HT-aktivitet. Aktivering av dette enzymet i blodet kan forårsake primær leverkreft og metastaser i dette organet fra svulster lokalisert andre steder..

Andre faktorer som påvirker GGT

Betennelse i bukspyttkjertelen og kreft i bukspyttkjertelen øker GGT-nivået.

Mange medisiner kan forårsake en økning i aktiviteten til gamma-GT i blodserum selv i mangel av tegn på skade på noen av organene. Disse inkluderer fenobarbital, fenytoin, warfarin, østrogener. Alkohol kan ha en lignende effekt..

anbefalinger

En analyse av gamma-GT utføres vanligvis på tom mage om morgenen, det vil si at pasienten ikke skal spise noe åtte timer før studien. For analyse tas blod fra fingeren eller ulnarven.

Informer alltid legen din om alle medisiner eller kosttilskudd du tar før du tar testen..

9 grunner til å øke nivået av gamma-glutamyltransferase i blodet

Ulike forbindelser inne i cellene i kroppen vår kan hjelpe til med diagnostisering av en rekke sykdommer. Så for eksempel kan leverenzymer indikere en patologi av dette organet hvis nivået i blodet stiger. En av dem er gamma glutamyl transferase (GGTP). Det vil bli sortert ut hva slags enzym det er, under hvilke spesifikke forhold det stiger i blodet.

GGTP - hva slags forbindelse er det og hvilke funksjoner utfører den

Hva er det?

GGTP står for gamma-glutamyl transpeptidase. Noen ganger kaller denne indikatoren GGT, som står for gamma-glutamyltransferase. Begge disse navnene refererer til det samme enzymet..

Hvor blir dannet

Dette enzymet kan finnes i tubulene i nyrenephronen, i epitelet som fôrer gallegangene. Det meste finnes i leverceller. Derfor, når disse vevene er skadet, kommer enzymet inn i blodomløpet, noe som gjør at legen kan diagnostisere en funksjonssvikt i disse organene.

Hovedfunksjoner

Glutamyltransferase er et enzym. Og enzymets viktigste rolle er å katalysere en reaksjon. GGT katalyserer reaksjonene ved glutamyloverføring til en aminosyre eller andre forbindelser. Denne overføringen er veldig viktig i utvekslingen av aminosyrer: enzymet fremmer deres transport, for eksempel gjennom tarmveggen fra dens lumen til blodet.

Når det utnevnes en analyse for å bestemme GGTP?

Definisjonen av denne typen transferase kan tilordnes separat eller i kombinasjon med andre leverenzymer, for eksempel aspartataminotransferase eller alaninaminotransferase for diagnostisering av tilstanden i levervekten..

Glutamyltranspeptidaseaktiviteten øker også når giftige stoffer, som visse medikamenter eller alkohol, blir utsatt for leveren. Så du kan forstå om leverskader var forårsaket av alkohol eller ikke..

Glutamyltransferase finnes ikke i bein. Følgelig vil ikke benvevs patologi påvirke nivået av GGT. Dette lar deg søke etter grunner til å øke et annet enzym - alkalisk fosfatase.

GGT lar deg også vurdere nyrenes tilstand, og i tilfelle brudd på arbeidet deres, vil dette enzymet fortelle legen om det.

Dermed muliggjør gamma-glutamyltransferase den differensielle diagnosen tilstander som forårsaker nedsatt leverfunksjon, patologi i nyrene og galleveiene.

Analyse forberedelse

Hvordan forberede?

Definisjonen av gamma-glutamyltransferase refererer til en rekke biokjemiske blodprøver. For å få nøyaktig informasjon om GGT i kroppen, må pasienten på riktig måte forberede seg til bloddonasjon.

Forberedelsesreglene er veldig enkle:

  • for biokjemiske studier, bør blod tas på tom mage, det vil si etter nattlig faste i 10 til 12 timer. Så du kan være sikker på at blodet vil være egnet for forskning og vil gjenspeile det nøyaktige innholdet av testparameteren i blodet;
  • Det anbefales å ikke røyke i flere timer før blodprøvetaking;
  • emosjonelle opplevelser dagen før analysen kan påvirke nøyaktigheten av resultatene fra studien;
  • trening og annen fysisk overbelastning av kroppen bør avskaffes. De kan også påvirke sluttresultatet;
  • Hvis medisiner er foreskrevet til pasienten, må du oppsøke lege - kan de påvirke nivået av enzymet i blodet? Pasienten skal ikke avlyse noe og utnevne seg!

Hvor du skal gi opp?

Blodprøvetaking for å bestemme nivået av glutamyltransferase skjer på et spesialkontor på en medisinsk institusjon. Oftest er det en klinikk på bostedet. Denne enkle analysen kan utføres i private medisinske organisasjoner..

Når du kontakter klinikken på bostedet, er bestemmelsen av gamma-glutamyltransferase gratis for pasienter med en obligatorisk medisinsk forsikring. Hvis pasienten uttrykte et ønske om å donere blod for å bestemme nivået av dette enzymet i et privat medisinsk senter, vil prisen for denne analysen være rundt 150 - 300 rubler.

Husk at en ekstra avgift belastes for selve blodprøvetakingsprosedyren. I gjennomsnitt vil dette være omtrent 150 - 300 rubler, avhengig av regionen.

Dekryptering av analyse

Norm for menn og kvinner

Grensene for normale gamma-glutamyltransferase-nivåer er forskjellige for menn og kvinner. Normen for kvinner er ikke mer enn 30 enheter per liter (U / L), og for menn - ikke mer enn 50.

I tillegg ble det kun gitt indikative standarder for GSTP. I hvert laboratorium kan standardene variere avhengig av hvilke testsystemer som brukes for å bestemme aktiviteten til dette enzymet i blodserum..

Gitt dette gjøres en studie av nivået av GGT i dynamikk best i det samme kliniske diagnostiske laboratoriet.

Normer hos barn

Normale nivåer av GGT hos barn er høyere enn hos voksne og varierer avhengig av barnets alder.

I den første uken av et barns liv bør nivået av GGTP ikke overstige 180 enheter per liter. Da kan enzymnivået øke, men ikke mer enn 200 enheter i løpet av første halvår.

Ved det første året av et barns liv reduseres nivået av gamma-glutamyltransferase til et nivå på ikke mer enn 35 enheter per liter. Under veksten og livet til barnet endrer nivået av glutamyltransferase ikke mye. Fra rundt tolvårsalderen blir normale enzymnivåer de samme som for en voksen.

Avvik fra normen

En endring i aktiviteten til enzymet glutamyltransferase mer enn referanseverdier indikerer patologi. I tillegg til sykdommer, kan medisiner føre til et avvik fra normen, men mer om det senere.

Noe som fører til en økning i GGTP?

Det er en rekke patologier i leveren og galleveiene, som er ledsaget av økt aktivitet av gamma-glutamyl transpeptidase. Disse inkluderer:

  • brudd på utstrømningen av galle gjennom kanalene på grunn av blokkering av lumen av en stein, en svulst, som forårsaker utvikling av mekanisk (hindrende eller subhepatisk) gulsott hos en pasient;
  • leverskade forårsaket av virkningen av alkohol, for eksempel hepatitt;
  • erstatning av bindevev, som kalles skrumplever;
  • pankreatitt - betennelse i bukspyttkjertelen;
  • autoimmun skade på leveren og gallegangene;
  • diabetes;
  • leverskade med smittsom mononukleose;
  • leverkreft;
  • nyrepatologi, for eksempel kronisk nyresvikt.

Rettelsesmetoder

Bare en lege kan korrigere nivåer av gamma-glutamyltransferase. Etter å ha analysert dataene til andre resultater av analysen, vil han kunne finne ut årsaken og utføre kompetent behandling av den primære sykdommen. Etter helbredelse vil nivået på enzymet gå tilbake til normalt..

For eksempel, hvis den økte aktiviteten til GGT er forårsaket av høyt alkoholforbruk, vil enzymnivået gå tilbake til normalt når du stopper bruken..

Hva kan føre til bedre resultater foruten sykdommer?

Unormale resultater av gamma-glutamyltransferase-nivåer kan være et resultat av alkoholmisbruk før dagen til en blodprøve. Det ble også nevnt tidligere at noen medikamenter kan påvirke resultatene av studien og overdrive de virkelige verdiene..

Disse medisinene inkluderer:

  • barbiturater,
  • statiner - en gruppe medikamenter som brukes til å senke kolesterolet i blodet;
  • antidepressiva;
  • noen typer antibiotika;
  • p-piller og noen andre hormonelle medisiner;
  • Aspirin, Paracetamol.

Det er også bemerket det faktum at hos overvektige individer nivået av enzymet vil være høyere enn normalt. Dette bør legen ta hensyn til når han tolker resultatene av studien..

Konklusjon

Gamma-glutamyltransferase er en viktig diagnostisk indikator. Dette enzymet lar deg diagnostisere lesjoner i leveren, galleveiene og nyrefunksjonen. GGT er en sensitiv indikator, derfor er det viktig å forberede deg på riktig måte.

Vi gjorde mye for at du kan lese denne artikkelen, og vi vil være glad for tilbakemeldingene dine i form av en vurdering. Forfatteren vil være glad for å se at du var interessert i dette materialet. takke!

Gamma GT økte hos kvinner

En biokjemisk blodprøve gir verdifull informasjon om en persons helsetilstand. En av de viktige indikatorene for biokjemi hos kvinner er GGTP, eller gamma-glutamyltransferase.

Hva er GGTP?

Med gamma-HT (synonymer - gamma-glutamyltranspeptidase, GGTP, gamma-glutamyltransferase) forstås et enzym som produseres av en rekke biokjemiske prosesser. Dette stoffet tar del i metabolismen av aminosyrer, finnes jevnlig i membranene til celler og inni dem. Mest av alt er det til stede i slike kropper:

  • lever;
  • nyrer
  • prostata;
  • bukspyttkjertelen.

Hvis gamma-hypertensjon er forhøyet, kan årsakene hos kvinner ligge i sykdommene i disse organene. Siden kvinner ikke har en prostata, vil nivået på gamma-GT normalt være mindre enn menns. I små mengder er gamma-glutamyltransferase til stede i andre organer, men verdien er ikke avgjørende.

En økning i indikatoren passerer aldri sporløst, den signaliserer alltid en dårlig kropp. De fleste GGTP i levervevet, derfor bør deres nederlag først utelukkes.

Hos kvinner regnes normen som verdien til 6-32 IE / liter, eller 10-66 enheter / liter (avhengig av målingen i et bestemt laboratorium).

Til sammenligning er tallet 18-100 enheter / liter, hos barn varierer det etter alder. Det er verdt å oppgi de vanligste årsakene til økningen av kvinner:

GGTP enzymforbedringMulig grunnHva annet kan problemet bety?
Mer enn 10 gangerLever svulsterAkutt hepatitt
5-10 gangerKronisk hepatittSkrumplever, galleblæresykdom
Mindre enn 5 gangerAlkoholismeHepatotoksiske medisiner

En blodprøve blir tatt på tom mage, den tilberedes i løpet av en dag. Etter at legen trekker konklusjoner om mulige forutsetninger for å øke enzymet.

Hvordan oppdage en økning i gamma-GT?

Med en rekke symptomer kan det mistenkes at gamma-HT-indeksen hos kvinner økes. Bare en liten økning i den kan ikke gi et klinisk bilde. Vanligvis, med alle patologier i lever-og gallesystemet som følger med veksten av gamma-GT, er stagnasjon av galle tilstede. Denne tilstanden kan manifestere seg:

  • gulsott i huden, gulfarging av sklera;
  • alvorlighetsgrad, smerter i leveren;
  • skarpe smerter etter å ha spist;

Ikke sjeldnere vises pasienten dyspeptiske lidelser - kvalme, oppkast, diaré. Noen ganger, i stedet for diaré, forekommer forstoppelse. Siden hjertesykdom til og med kan være årsaken til GGT, kan brystsmerter, blekhet, besvimelse, kortpustethet følge med dem..

Kolestase - hovedårsaken til vekstraten

Med patologier i lever-og gallesystemet oppstår kolestase - denne tilstanden betyr at galle reduserer utskillelseshastigheten. Årsaken er både opphør av transporten langs galleveiene, og avtakelsen i produksjonen i leveren.

Konsentrasjonen av gamma-GT hos kvinner øker ofte på grunn av leversykdommer.

Blokkering av utstrømningen av galle kan noteres i de avanserte stadiene av skrumplever, med alvorlig fetthepatose. Hvis nivået av ASAT og ALAT i leveren samtidig økes, kan virus Hepatitt A, B, sjeldnere mistenkes C. Utenfor den inflammatoriske prosessen øker nivået av gamma-glutamyltransferase med giftig leverskade, forgiftning og skleroserende kolangitt. Alle disse sykdommene forårsaker intrahepatisk kolestase, som også er ledsaget av en økning i bilirubin..

Ekstrahepatisk kolestase kan gi de samme konsekvensene når kanaler som ligger utenfor leveren blir forstyrret. Dette betyr at galleblæren påvirkes av slike sykdommer:

  • steiner i orgelet;
  • slangesyndrom (tykkelse av galle);

Alle disse patologiene forårsaker ofte en samtidig økning i alkalisk fosfatase i blodet. Behandlingen vil fokusere på å forbedre utstrømningen av galle og blokkere betennelse..

Tumorprosesser

Kreft i leveren og andre organer i lever-og gallesystemet er primær og metastatisk. Hvis kreftceller formerer seg i organer, begynner leverprøver og gamma-GT å bli frigjort i et forbedret volum. Ved store svulster er det ved dekoding av analysen et alvorlig overskudd av indikatoren - 10 ganger eller mer.

I de første stadiene av onkologien kan overskuddet av enzymet være moderat.

Blant annet er en bukspyttkjertelsvulst i stand til å forårsake endringer i analysene. Dette organet er ansvarlig for produksjonen av et antall aminosyrer som inkluderer gamma-glutamyltranspeptidase.

Andre mulige årsaker

Det anbefales at alle som går gjennom lange behandlingsforløp, gjør regelmessige undersøkelser og blodprøver. Mange piller forårsaker cytolyse (celledød) i leveren. Dette provoserer inntrengning av et stort antall leverenzymer i blodet. Hos kvinner skjer dette ofte med et kurs med østrogen og kortikosteroider. Den samme effekten er gitt:

  • medisiner mot tuberkulose;
  • en rekke antibiotika, spesielt tetracykliner;

For behandling bør du ta et kurs for å ta hepatoprotectors - Essential, Heptral. Alle giftstoffer, så vel som alkohol, har giftige effekter på leveren. Ved kronisk alkoholisme kan mengden enzym alltid økes, og selv etter å ha gitt opp alkohol normaliseres det ikke umiddelbart. Av de mer sjeldne årsakene til veksten av gamma-GT hos kvinner, bør det kalles:

  • systemisk lupus erythematosus;

I noen tilfeller er enzymet forhøyet med tyrotoksikose - hypertyreose. Alle disse patologiene fortsetter ikke uten ytterligere symptomer og oppdages lett under undersøkelse.

Gamma GT økte hos menn

GGT (gamma-glutamyltransferase) er et enzym som hovedsakelig akkumuleres i det menneskelige utskillelsessystemet og gjenspeiler tilstanden. En test for GGT blir ofte tatt i forbindelse med andre laboratorietester for kompetent diagnose av sykdommer.

Hva er GGT?

I medisinsk praksis er GGT kjent for et annet navn - GGTP (gamma-glutamyltranspeptidase). Gamma-HT er ikke inneholdt i blodet, men det kommer inn i sirkulasjonssystemet når cellen blir ødelagt. Denne prosessen forårsaker konstante svingninger i verdien av enzymet (spesielt en økning).

Hovedmålet med GGT er å stimulere kroppens biokjemiske prosesser, for eksempel lever avgiftning. Ved å ta en prøve er det således mulig å pålitelig bestemme tilstedeværelsen av en patologisk prosess i følgende organer:

  • nyrer
  • lever;
  • milt;
  • prostata;
  • galleblære.

Med sykdommer i andre organer øker også GGT.

Årsaker til enzymforbedring

Den økte verdien av GGT-enzymet indikerer først og fremst patologiske prosesser av organer. Men det er ett forbehold: hvis personen i løpet av dagen før testen drakk alkohol, er det sannsynlig at dette vil påvirke resultatene av testen.

Alkoholfølsomhet av gamma-GT-enzymet tillater nøyaktig gjenkjennelse av kronisk alkoholisme.

GGT-prøven er ikke en stabil, konstant verdi. En endring i enzymindeksen er ofte midlertidig og går tilbake til normal når grunnårsaken er eliminert. La oss vurdere alle faktorene hver for seg.

Når GGT stiger litt og midlertidig?

Hvis andre indikatorer for laboratorieforskning ikke indikerer utvikling av patologi, er det ingen grunn til bekymring. Resultatet av testen påvirkes av alkoholinntak, så vel som andre faktorer:

  • å ta medisiner som tykner galle;
  • lav fysisk aktivitet;
  • overvekt;

En moderat økning i GGT indikerer allerede betennelsesprosesser i kroppen. Hvis resultatet av prøven blir overvurdert med 2-3 ganger, utelukk sykdommer i galleveiene og bukspyttkjertelen (bukspyttkjertelen).

Prøveresultater påvirkes av:

  • hepatotoksiske medikamenter (NSAIDs, barbiturater, p-piller, antipsykotika, antibiotika);
  • mononukleose;
  • nevrologiske sykdommer;
  • brannsår;
  • skader
  • hepatitt;

Laboratorieresultater bekreftes av de karakteristiske symptomene for hver spesifikk sykdom.

Hvorfor oppstår kritiske gamma-GT-nivåer??

Kritiske verdier av GGT-resultater (10 ganger avvik fra normen) provoserer alvorlige, kroniske sykdommer:

  • hjerteinfarkt;
  • hjertefeil;

Langvarig alkoholforbruk øker GGT med 10-30 ganger! For å bringe gamma-GT til det normale vil det ta fra flere dager til flere uker å forlate alkohol helt.

Årsakene til økningen i gamma-GT hos menn er oftere forårsaket av en prostata svulst eller kronisk alkoholisme.

Varigheten av utvinningsperioden påvirkes av:

  • varighet og hyppighet av bruk;
  • type alkoholholdig drikk, konsumert mengde;
  • levertilstand og generell tilstand i kroppen.

I fremtiden, ved å bruke analysen på GGTP, overvåkes effektiviteten av behandlingen og hastigheten på restaurering av det berørte organet.

Gamma-GT verdier

Normalt er gamma-HT til stede i den cytoplasmatiske og membranstrukturen til celler. Samtidig bemerkes det at hos kvinner er den normale indikatoren 2 ganger lavere, i motsetning til menn. Dette skyldes tilstedeværelsen av en prostatakjertel hos menn..

Hos nyfødte er verdien av GGT ekstremt høy, men normaliseres i løpet av de første månedene av livet. Ytterligere indikatorer for normen er gitt i tall.

GGT-normer
AlderKvinner, ME / LMenn IU / L
Newbornfram til 185fram til 185
5 dager - 6 månederfram til 203fram til 203
fra 6 til 12 månederikke mer enn 35ikke mer enn 35
1-3 årfør 18før 18
3-6 år gammelopp til 22opp til 22
fra 6 til 12 årikke mer enn 16ikke mer enn 16
fra 12 til 18 år gammelopp til 34opp til 46
fra 18 år gammelfra 6 til 42fra 10 til 71

For analyse av gamma-GT, blir bare blodprøvetaking fra morgenen fra en blodåre gjort. For riktig verdi av gamma-GT i henhold til resultatene fra studien, må du forlate dagen etter:

  • inntak av alkoholholdige så vel som lite alkoholholdige drikker;
  • overdreven fysisk anstrengelse;
  • ta medisiner;
  • røyke.

Stressige situasjoner unngås også når det er mulig. Tidsintervallet mellom siste måltid og blodprøvetaking bør være minst 12 timer.

Hvordan justere verdien på enzymet?

Hvis resultatene fra studien indikerer økt hastighet gamma-glutamintransferase, er det ikke bare meningsløst, farlig å justere enzymnivået selv. Bare en lege kan pålitelig fastslå årsaken til avviket fra normale verdier og foreskrive adekvat behandling.

Du kan fortsatt hjelpe kroppen, i tillegg til medikamentell terapi. For å gjøre dette, bør du vurdere kostholdet nøye og justere det. For å normalisere GGT, anbefales det å berike kostholdet med følgende produkter:

En obligatorisk egenskap av helse er å opprettholde en sunn livsstil: skåne fysisk aktivitet, mangel på stress, gi opp sigaretter og alkohol.

del med vennene dine

Gjør en god jobb, det vil ikke ta lang tid

GGT i en biokjemisk blodprøve

Andre årsaker til økningen

Hvis gammaet til glutamyltransferase økes flere ganger, kan dette si:

  • sukkersyke;
  • pankreatitt;
  • thyrotoxicosis;
  • alvorlig hjertesvikt, som bidrar til utvikling av hjertesirrhose i leveren;
  • nyrepatologier: pyelonefritt, glomerulonefritt, ledsaget av nefrotisk syndrom, kronisk nyresvikt;
  • nevrologiske patologier;
  • mekaniske skader;
  • patologier av GM;
  • brannskader på 3-4 grader av alvorlighetsgrad;
  • tar hormonelle medisiner foreskrevet for å normalisere skjoldbrusk funksjon.

Og likevel, ifølge leger, hvis nivået på gamma GT økes to ganger eller mer, bør årsaken søkes nøyaktig i leveren. Mange leverpatologier over lengre tid vil kanskje ikke gi seg bort, derfor er den eneste måten å oppdage dem på analyse på GGTP.

Hos menn

Hvis nivået av ggt økes i en biologisk blodprøve hos menn, indikerer dette i de fleste tilfeller en funksjonsfeil i prostatakjertelen. Imidlertid er det verdt å vurdere det faktum at hvis vi sammenligner ytelsen til dette proteinet i blodet hos mannlige og kvinnelige pasienter, så er de i førstnevnte alltid mye høyere. Dette skyldes de fysiologiske egenskapene til den mannlige kroppen. Fakta er at gamma glutamyltransferase i dem akkumuleres i prostatakjertelen, nyrene og leveren, noe som ikke annet enn kan gjenspeiles i resultatene av en biokjemisk blodprøve.

Men hvis det er en patologisk prosess, er det flere faktorer som kan forklare hvorfor nivået av gamma GT i blodprøven hos menn økes:

  • prostatakreft;
  • brudd i arbeidet med prostata;
  • overført eller latent forløp av leversykdommer;
  • kronisk alkoholisme.

Blant kvinner

Årsakene til at nivået av gamma GT er forhøyet hos kvinner kan gjemme seg i funksjonsfeil i brystkjertlene, skjoldbruskkjertelen eller nyrene. Imidlertid kan man ikke utelukke problemer fra galleblæren og funksjonsfeil i hormonell bakgrunn fra denne listen..

Så hvis GGT økes flere ganger, kan dette indikere utviklingen av en ondartet svulst i pasientens brystkjertler. Nivået av dette proteinet i blodet vil øke når den kreftfremkallende prosessen sprer seg. Spesielt høye frekvenser observeres i stadium av brystkreftmetastase, og denne tilstanden er allerede potensielt livstruende for en kvinne.

Hvis gamma glutamyltransferase er forhøyet, men det ikke er noen unormale funksjoner i de indre organene, kan en hormontest foreskrives for pasienten.

Implementeringen av dette er spesielt viktig hvis en kvinne tar orale hormonelle prevensjonsmidler i lang tid. Når du slutter å ta nivået av gamma, går GT tilbake til det normale etter 7-14 dager

Det er bevist at kvinner lider av en slik patologi som tyrotoksikose, dobbelt så ofte som menn. Derfor, hvis en blodprøve viste at gammaet til hypertensjon er økt, er det nødvendig å undersøke pasienten nøye for avvik (i dette tilfellet, hyperfunksjon) i skjoldbruskkjertelen.

Hos gravide kan nivået av dette proteinet i blodet også øke betydelig. Først av alt skyldes dette belastningen på nyrene. I tillegg er utviklingen av pyelonefritt eller glomerulonefritt hos vordende mødre, dessverre, ikke uvanlig.

Leverproblemer, kraftig økning i vekt og forstyrrelser i funksjonen av hjertemuskelen er ikke utelukket. Alle disse faktorene kan også føre til en økning i gamma av GTP i blodet..

Årsaker til avvik

GGT-indikatorer i analysen kan avvike fra normen i større eller mindre grad. Legen bør analysere dataene nøye og identifisere årsakene til avviket, og deretter foreskrive riktig behandling.

Hvis GGT er forhøyet, kan vi snakke om følgende patologier:

  • brudd på tålmodighet i galleveiene, som kan være forårsaket av utseendet på steiner, neoplasmer, postoperative arr, kreft i bukspyttkjertelen;
  • akutt eller kronisk hepatitt;
  • smittsom mononukleose, med spredning av infeksjon til leveren;
  • pankreatitt,
  • noen autoimmune sykdommer;
  • diabetes;
  • prostata eller brystkreft;
  • hjertesvikt eller hjerteinfarkt, der konsentrasjonen av enzymet øker den fjerde dagen etter sykdommens begynnelse;
  • leddgikt.

Et høyt nivå av GGTP kan være forårsaket av bruk av visse typer medisiner: aspirin, paracetamol, antibakterielle, hormonelle eller prevensjonsmedisiner, og andre medisiner..

Et lavt enzymnivå kan være forårsaket av tre grunner:

  • hypotyreose;
  • tar visse medisiner som senker kolesterol og triglyserider i blodet, for eksempel clofibrat;
  • postterapeutisk effekt hos pasienter som er kurert av alkoholavhengighet. Etanol stimulerer den intensive produksjonen av enzymer fra levercellene, og derfor reduserer fraværet av en ekstra stimulant kraftig syntesen av GGT og påvirker følgelig konsentrasjonen i blodet.

Legen bør dechiffrere de biokjemiske analyseparametrene grundig, analysere ikke bare nivået av GGT, men også mengden andre leverenzymer, bilirubin, lipase, etc..

Å gjennomføre en biokjemisk blodprøve på nivå med GGT vil avsløre sykdommen i leveren, bukspyttkjertelen i de aller første utviklingsstadiene. Takket være dette vil legen kunne forskrive en effektiv behandling. Og implementeringen av legens anbefalinger vil tillate på kort tid å normalisere alle blodverdier og funksjonene til kroppssystemer.

Hvis det er et brudd i leverens arbeid, forekommer visse symptomer som indikerer en bestemt patologi. For å avklare diagnosen tillater også laboratorietester, ofte kalt “leverprøver”, enzymprøver. Av stor betydning når det gjelder å oppdage en eller annen forstyrrelse i leverens funksjon er et enzym som GGT (GGTP). Denne forkortelsen står for gamma-glutamyltranspeptidase.

I analyseformene er enzymet gamma glutamyl transpeptidase definert som GGT (y-glutamyltransferase) eller GGTP (Gamma glutamyl transpeptidase). Dette enzymet er involvert i metabolismen av aminosyrer i kroppen. Det finnes i forskjellige organer, men mest av alt i leveren, nyrene, bukspyttkjertelen, gallegangene og milten. Det ligger i de ytre membranene av organer.

GGTP deltar i prosessen med å konstruere proteinmolekyler, stimulerer forskjellige biologiske reaksjoner som er nødvendige for implementering av viktige funksjoner i kroppen. Derfor bestemmes GGT-enzymet under utførelsen av en biokjemisk blodprøve sammen med indikatorer som ALT, AcT og alkalisk fosfatase.

Nivået på GGT-enzymet bør tas hensyn til når det er symptomer som indikerer betennelsesprosesser i leveren, men de er ikke nok til å stille en nøyaktig diagnose. For eksempel i de tidlige stadiene av hepatitt

GGT er også viktig når det gjelder å spore dynamikken i utviklingen av kroniske sykdommer som påvirker leverparenkym

Normer for gammaglutamyltransferase

Hos mannlige og kvinnelige pasienter er glutamyltransferase sjelden forskjellig. Denne analysen kan foreskrives for barn, spedbarn, nyfødte..

Den normale verdien i kroppen til en sunn person skal ikke overstige en indikator på 8-70 enheter per liter blod. Hos kvinner er den optimale normen flere ganger mindre. Gode ​​helseindikatorer hos nyfødte - 185 enheter per liter blod. Dette betyr at patologiske prosesser er fraværende. Hos barn under seks år regnes 200 enheter per liter som normen.

Når leger finner en økning i enzymet i babyens blod, anbefaler de å ikke få panikk. Babyens kropp kan ikke uavhengig produsere dette stoffet. Denne prosessen er assosiert med det faktum at morkaken forsyner babyen med alle nødvendige stoffer, hjelper de indre organene til å fungere korrekt.

Norm hos kvinner

Avhengig av alder, kan nivået på enzymet i blodet variere veldig. Alle bør vite hva GGT vil vise og hvilke indikatorer som anses som akseptable. Det er visse standarder som vil bidra til å gjøre riktig dekoding av analysen:

AlderIndikatorer i enheter på 1 liter blod
Fra fødsel til 5 dager i livet185
5 dager til 6 månederMaksimal tillatt verdi 202
6 måneder til 1 år34
1-3 åratten
3-6 år gammel22
6-12 år gammelseksten
12-17 år gammel33
Fra 18 år6-42

Indikatoren kan være annerledes. Det hele avhenger av utstyret som brukes til diagnostikk, samt måleenhetene. Noen ganger varierer nivået med pasientens rase.

Før diagnose, må du ta hensyn til regler og krav

Undersøkelse kan foreskrives for gravide. I dette tilfellet er det en annen dekrypteringsplan:

  • i perioden første trimester øker ikke indikatoren til 17 enheter hvis det ikke er noen alvorlige patologiske prosesser i kroppen;
  • i andre trimester kan nivået på enzymet øke til 33 enheter;
  • etter 30 uker, reduseres hastigheten med en enhet.

Det er situasjoner når proteinet i blodet øker dramatisk. I dette tilfellet får pasienten sammen med hoveddiagnosen forskrevet en ekstra bloddonasjon etter kort tid for å spore dynamikken i glutamyltranseptidase. Hvis hoppet er midlertidig, ikke bekymre deg. Under graviditet gjennomgår en kvinnes kropp sterke forandringer. Glutamyltransferaseindeks endres ofte avhengig av bruken av vitaminkomplekser. Dette betyr at legen må snakke om alle medisinene som ble brukt før testen.

Norm hos menn

Disse indikatorene øker til en viss verdi. Under diagnosen blir legene veiledet av følgende tabell:

Alder på pasientOptimale verdier i enheter per liter blod
Fra fødsel til 5 dager i livet185
5 dager til 6 måneder202
Fra 6 måneder til det første leveåret34
1-3 årIkke mer enn 18
3-6 år gammel22
12-18 år gammelInnen 45
18 år og eldre10-70

Normen hos menn er flere ganger høyere på grunn av den økte konsentrasjonen av enzymer som er i prostata. Det er tider hvor det observeres en kraftig økning i kroppen. I dette tilfellet får pasienten forskrevet en omfattende undersøkelse for å bestemme mulige avvik i leveren, bukspyttkjertelen. Noen ganger oppstår en slik funksjonsfeil som et resultat av funksjonsfeil i indre organer.

Årsaker til økt GGT i blodet

Sykdom / tilstandBeskrivelse
Akutt hepatitt (viral A, B, C, D, giftig, alkoholiker, medisinsk...)Akutt leverskade med smittsomme, giftige eller kjemiske midler
Kronisk hepatitt (viral, alkoholisk, autoimmun, giftig, medikamentelt, uidentifisert...)Nekrose og betennelse i leverstrukturene, som eksisterer i mer enn 6 måneder
Steatosis (fetthepatose)Fett degenerasjon av leveren - introduksjon av fett inne i levercellene
LeverfibroseSubstituering av leverceller med bindevev
skrumpleverProgressiv død og en reduksjon i antall hepatocytter, noe som fører til strukturell omorganisering av organvev og leversvikt
Postnekrotisk skrumpleverUtfallet av mange leversykdommer
Primær gallesirrhoseKronisk betennelse og fibrøs infeksjon i de intrahepatiske kanalene
Sekundær gallesirrhoseTilstand forårsaket av langvarig blokkering av de store ytre gallegangene
Primær skleroserende kolangittKronisk kolestase av ukjent etiologi, og fortsetter med fibrøs betennelse i intra- og ekstrahepatiske kanaler
HjertesirrhoseResultatet av stagnasjon av blod i leveren med langvarig hjertesvikt i høyre ventrikkel
Budd-Chiari-syndromTrombose i levervenen på grunn av okklusjon, nedsatt tålmodighet i leveren eller dårligere vena cava
Lever svulsterLeverkreft (primært karsinom), levermetastaser, godartede svulster i leveren (hemangiomas, cyster, etc.)
Arvelige sykdommerHemokromatose, Wilson-Konovalov sykdom, Niman-Peak sykdom, Gauchersykdom, a-antitrypsinmangel, cystisk fibrose
Kolecystitt, galle-dyskinesiBetennelse i galleblæren, nedsatt bevegelighet i gallegangen
gallesteinDannelse av steiner i galleblæren og gallegangene
kolangittAkutt eller kronisk betennelse i gallegangene av forskjellig art
Smittsom mononukleoseAkutt Epstein-Barr Herpes virusinfeksjon
Okklusjon av gallegangHindring eller dårlig tetthet i galleveiene på grunn av en svulst, cyste, striktur (innsnevring, innsnevring)
pankreatittBukspyttkjertelbetennelse
Ondartede svulster i bukhulenKreft i bukspyttkjertelen Magesekreft Prostatakreft
helminthiasisLeverskade av parasitter: lever trematode, echinococcus, etc..
Diabetes, hypertyreoseEndokrine sykdommer
Alkohol inntakGHTP-syntesestimulering, alkoholisk leverskade
Bruk av medisiner eller medikamenterMedisinsk induksjon av GGTP, kjemisk, medikament toksisk leverskade

Hvilke medisiner påvirker GGTP

GGTP-analyse er påvirket av stoffer som endrer viskositeten til galle, dens hastighet langs kanalene, medikamenter som induserer aktiv syntese av enzymet, og medisiner med hepatotoksisk effekt.

Disse medikamentene øker GGTP i blodet: - Fenytoin - Fenobarbital - Trisykliske antidepressiva - Paracetamol, nimesulid, andre NSAIDs - Karbamazepin - Klorpromazin - Klorpropamid - Nifedipin - Syklosporin - Hormonelle prevensjonsmidler, kjønnshormoner Antagonister Nitrofuraner - Klorpropamid - Azathioprine - Propafenon - H2-histaminreseptorblokkere - Cotopril - Sulpiride - Noen medisinske urter - dr.

Etter uttak av medikamenter gjenopprettes nivået av GGTP i blodet uavhengig innen 1-3 måneder.

Å dechiffrere resultatene

Tolkningen av analysen utføres av den behandlende legen. Basert på dem kan han bekrefte eller avkrefte tilstedeværelsen av en rekke patologier i kroppen.

En økning i nivået av enzymet observeres ved kolestase, akutt og kronisk hepatitt, pankreatitt. Det er en endring i indikatorer og i nærvær av alkoholavhengighet hos pasienten, ondartede svulster.

Konsentrasjonen kan øke i større grad når du tar prevensjonsmidler og en rekke andre medisiner.

Gamma-glutamyltranspeptidase avhenger av kjønn og aldersgruppe til pasienten.

Metodene for å behandle en blodprøve er forskjellige, så vel som utstyret for dets undersøkelse, slik at de innstilte verdiene kan avhenge av utstyret eller pasientens alder..

Hvis en undersøkelse av pasienten avdekket en økning i nivået av enzymet, bør du ikke være redd for dette. For å identifisere sykdommer og diagnostisere dem, er det nødvendig å korrelere data om blodprøver med ALT eller AST.

Denne verdien kan indikere for legen omfanget av lunger i leveren..

Hvis prøven er mer enn 50 ganger høyere enn den normale indikatoren, og de resterende enzymene forblir uendret, betyr det at pasienten har kronisk alkoholisme.

Nivået av gamma gt stiger også hos tunge røykere som røyker mer enn 40 sigaretter per dag.

Tilsvarende indikatorer blir også påvist når de dekoder analysen hos overvektige mennesker, spesielt hvis BMI deres er mer enn 30 enheter.

I disse tilfellene kan komponenten øke med 50%.

Økt Gamma GT hos kvinner

De normative indikatorene for GGT hos kvinner kan økes litt i følgende tilfeller:

  • onkologiske formasjoner i brystkjertelen;
  • bruk av hormonelle prevensjonsmidler eller medisiner for å støtte balansen mellom kvinnelige hormoner;
  • under graviditet.

I alle fall utarbeides behandlingsregimet av den behandlende lege, avhengig av størrelsen på GGT-overskuddet, så vel som alvorlighetsgraden av den primære sykdommen.

Først av alt er rotårsaken eliminert, etterfulgt av streng overholdelse av kostholdet og medisinsk støtte for leveren. I de mest ekstreme tilfeller er kirurgisk inngrep indikert (for onkologi).

Gamma-GT-analyse i diagnosen leversykdommer

Biokjemisk analyse

Konsentrasjonen av gamma-GT informerer oss om leveren, nyrene, bukspyttkjertelen og prostatakjertelen. Finn ut hvilke GGT-standarder som finnes.

Biokjemisk analyse av GGT blir utført i diagnosen sykdommer i lever og galleveier. Resultatene av studien avhenger av flere faktorer. Vurder normene og avvikene.

Normen for kvinner er 10-66 U / L, og for menn - 18-100 U / L. Økte GGT-nivåer - fra 120 til 1000 U / L.

Leversykdom

En økning i aktiviteten til dette enzymet kan føre til et bredt spekter av leversykdommer. Disse inkluderer:

2. Blokkering av sekresjon av galle eller galleveier (kolestase). Også i dette tilfellet dominerer en økning i gamma-GT-aktivitet blant biokjemiske forandringer (spesielt ved ekstrahepatisk kolestase). Kanskje til og med mer enn ti ganger kan det overstige normen. Galle produseres av levercellene, kommer først inn i galleblæren og deretter inn i tarmen. Blokkering av utstrømning (eller utskillelse av celler) kan ha forskjellige årsaker:

  • sykdom i fordøyelsessystemet;
  • gallestein;
  • skrumplever i leveren;
  • galleblæresykdom;
  • bruk av visse medisiner;
  • tumorer;
  • cyster;
  • infeksjoner.

Et typisk symptom på kolestase er en betydelig økning i blodaktiviteten til alkalisk fosfatase (ALP), samt bilirubinkonsentrasjon.

4. Hepatitt C er ofte manifestert gjennom virus: HAV, HBV, HCV. Mengden gamma-GT i serum kan øke med betennelse i leveren. Ved akutt hepatitt observeres imidlertid først og fremst en stor økning i aminotransferase-aktivitet..

6. Svulster i leveren kan forårsake en betydelig (flere ganger høyere enn øvre normalgrense) økning i gamma-HT-aktivitet. Aktivering av dette enzymet i blodet kan forårsake primær leverkreft og metastaser i dette organet fra svulster lokalisert andre steder..

Andre faktorer som påvirker GGT

Betennelse i bukspyttkjertelen og kreft i bukspyttkjertelen øker GGT-nivået.

Mange medisiner kan forårsake en økning i aktiviteten til gamma-GT i blodserum selv i mangel av tegn på skade på noen av organene. Disse inkluderer fenobarbital, fenytoin, warfarin, østrogener. Alkohol kan ha en lignende effekt..

anbefalinger

En analyse av gamma-GT utføres vanligvis på tom mage om morgenen, det vil si at pasienten ikke skal spise noe åtte timer før studien. For analyse tas blod fra fingeren eller ulnarven.

Informer alltid legen din om alle medisiner eller kosttilskudd du tar før du tar testen..

Gamma glutamyltransferase forhøyet - hva betyr det?

En moderat økning i GGT i blodet (1-3 ganger) oppstår på grunn av infeksjon med viral hepatitt (noen ganger observeres et 6 ganger overskudd), når du tar hepatotoksiske medisiner (fenytoin, cefalosporiner, p-piller, acetaminophen, barbiturater, østrogener, rifampicin og andre)., kolecystitt, pankreatitt, posthepatisk skrumplever, smittsom mononukleose (ledsaget av feber, hovne lymfeknuter).

Årsaker til å øke gamma-glutamyltransferase 10 ganger eller mer:

  • gulsott som et resultat av et brudd på utstrømningen av galle og en økning i intraductal trykk;
  • forgiftning og giftig skade på leveren;
  • neoplasmer i leveren og bukspyttkjertelen, hos menn - prostata;
  • diabetes;
  • hjerteinfarkt;
  • leddgikt;
  • hypertyreose;
  • kronisk alkoholisme og en rekke andre sykdommer.

Ved langvarig bruk av alkohol økes nivået av GGT med 10-30 ganger (forholdet mellom gamma-glutamyltransferase og AST er omtrent 6). Mengden, varigheten og bruken av alkoholholdige produkter påvirker innholdet av dette enzymet i blodet.

Varigheten av denne perioden bestemmes av typen tidligere konsumert alkohol, dens mengde, leverens tilstand og andre organer, samt hvor lenge en person har konsumert alkohol og andre faktorer..

Hva gjør man hvis gamma-glutamyltransferase er forhøyet?

Siden et forhøyet nivå av GGT i blodet ikke diagnostiserer sykdommen nøyaktig og kan være forårsaket av andre årsaker, foreskriver legen en ytterligere undersøkelse av leveren.

Først av alt er dette bestemmelsen av nivået av transaminaser - ALT (alaninaminotransferase), AST (aspartataminotransferase), så vel som alkalisk fosfatase. En sammenligning av GGT-nivået med innholdet av ALT og alkalisk fosfatase (ALP) i blodet kan skille en del av sykdommene (en ytterligere undersøkelse er nødvendig for å stille en nøyaktig diagnose).

Spesielt hvis GGT er høyere enn 100, er ALT lavere enn 80, alkalisk fosfatase er mindre enn 200, kan være med:

  • drikker mye alkohol;
  • å ta narkotiske stoffer;
  • diabetes
  • inflammatoriske prosesser i fordøyelseskanalen;
  • vektig;
  • økte triglyserider;
  • tar visse medisiner.

GGT i den biokjemiske analysen av blod overstiger 100, ALT mindre enn 80 og alkalisk fosfatase er mer enn 200 observert med:

  • bremse utstrømningen av galle på bakgrunn av overdreven alkoholforbruk;
  • reduksjon i utstrømning av galle som et resultat av skrumplever i leveren;
  • vanskeligheter med utstrømning av galle på grunn av steiner i galleblæren eller kompresjon av gallegangen ved neoplasmer;
  • andre grunner.

En økning i nivået av gamma-glutamyltransferase til 100, med ALT og AST over 80 og alkalisk fosfatase mindre enn 200, kan bety:

  • tilstedeværelsen av viral hepatitt (A, B eller C) eller Epstein-Barr-virus (noen ganger viral hepatitt forekommer uten en økning i nivået av leverenzymer);
  • overdreven levereffekt av alkohol;
  • fet hepatose.

GGT-indeksen økes til 100, ALT overstiger 80 og alkalisk fosfatase overstiger 200. Dette betyr at utstrømning av galle er vanskelig og leverceller blir skadet. Blant årsakene til denne tilstanden er:

  • kronisk hepatitt av alkoholisk eller viral natur;
  • autoimmun hepatitt;
  • neoplasmer i leveren;
  • skrumplever i leveren.

GGT-indikatoren i en biokjemisk blodprøve diagnostiserer stagnasjon av galle. Dette er en veldig følsom markør for kolangitt (betennelse i gallegangen) og kolecystitt (betennelse i galleblæren) - den stiger tidligere enn andre leverenzymer (ALT, ACT). En moderat økning i GGT er observert med smittsom hepatitt og overvekt (2-5 ganger høyere enn normalt).

De beste sanatoriene for leverbehandling: behandlingsmetoder, tilstander, priser

Årsaker til økt GGT i blodet

Med en rekke symptomer kan det mistenkes at gamma-HT-indeksen hos kvinner økes. Bare en liten økning i den kan ikke gi et klinisk bilde. Vanligvis, med alle patologier i lever-og gallesystemet som følger med veksten av gamma-GT, er stagnasjon av galle tilstede. Denne tilstanden kan manifestere seg:

  • gulsott i huden, gulfarging av sklera;
  • alvorlighetsgrad, smerter i leveren;

skarpe smerter etter å ha spist;

  • svakhet, redusert ytelse.
  • Det er et stort antall sykdommer og faktorer, hvis tilstedeværelse provoserer en økning i konsentrasjonen av gamma-glutamyltranseptidase. Alle av dem medfører skade på levervevets, bukspyttkjertelen, veggene i galleblæren, mage, nemlig:

    • hindring av gallegangene, som oppsto i forbindelse med utvikling av mekanisk gulsott;
    • en svulst i mageveggen, som komprimerer galleblæren og dens kanaler, og forstyrrer deres normale drift;

    Kronisk drikking øker GGT i blodkjemi

  • kronisk alkoholisme (etter fullstendig avvisning av alkoholholdige drikker, kan en økt konsentrasjon av GGT i blodomløpet vedvare i ytterligere en måned, selv om 30% av personene skilte ut proteinenzym 3 ganger raskere);
  • steiner i galleblæren og kanalene;
  • kirurgisk inngrep i leveren, magen, galleblæren, bukspyttkjertelen;
  • kolangitt i skleroserende type, så vel som galle-skrumplever (det spiller ingen rolle hvilke faktorer som forårsaket massedød av leverceller);
  • smittsom mononukleose som foregår i en komplisert form (leveren og milten er involvert i den inflammatoriske prosessen forårsaket av den virale mikroorganismen, derfor en økning i disse organene i volum, samt skade på vevet deres);
  • onkologisk neoplasma i hodet av bukspyttkjertelen;
  • akutt eller kronisk hepatitt, som har rus (eksponering for kjemikalier med giftig etiologi), alkoholholdig eller viral opprinnelse (denne patologien er preget av de høyeste nivåene av GGT, så vel som en kraftig bølge i alkaliske fosfataseforbindelser);
  • pankreatitt forårsaket av forgiftning med alkohol, eller ervervet gjennom hele livet på grunn av de negative effektene av andre faktorer;
  • kronisk hjertesvikt;
  • lupus erythematosus (en farlig systemisk sykdom under utviklingen av hvilken menneskets immunitet begynner å produsere spesifikke antistoffer i forhold til dets eget vev i indre organer);
  • hypertyreose i skjoldbruskkjertelen, når den begynner å syntetisere et stort antall hormoner som forstyrrer leveren;
  • en kreft i lungene eller kjertelvevet i brystet, hvis metastaser har spredd seg til leveren;
  • hjerteinfarkt (en økning i GGT-nivåer observeres 3-4 dager etter anfallet, fordi leverens belastning øker på grunn av hjertefunksjon);
  • diabetes.
  • GGT i den biokjemiske sammensetningen i blodet økes til den behandlende legen undersøker pasienten, fastslår den sanne årsaken til den høye konsentrasjonen av proteinenzymet og tar tiltak for å redusere nivået av gamma-glutamyltranseptidase.

    Rettidig start av behandling for en påvist sykdom gjør det mulig å undertrykke ytterligere ødeleggelse av leverceller og bringe den biokjemiske sammensetningen av blod til normal.

    En økt konsentrasjon av gamma-glutamyltranspeptidase i blodet er ikke farlig for helse og liv. Trusselen kommer fra sykdommer som utløste en økning i nivået av proteinenzym. De fleste av patologiene er listet opp i avsnittet ovenfor, og kan føre til et langvarig fordøyelses- og endokrine systemopprør..

    I tillegg kan mangel på behandling for sykdommer som hepatitt, skrumplever, pankreatitt, onkologiske prosesser i vev i magen, leveren, bukspyttkjertelen, galleblæren og dens kanaler føre til død.

    Hva er leverpanelet

    Siden GGT-analyse bør vurderes med andre tester, må det huskes at dette enzymet vanligvis kommer inn i leverpanelet, som brukes til å screene for leverskader. Det er spesielt relevant for pasienter som gjennomgår behandling som kan påvirke leveren.

    Leverpanelet eller dens individuelle deler er beregnet på diagnose av leversykdommer, hvis pasienten har symptomer og tegn på sykdommer i dette organet. Hvis sykdommen er etablert, gjentas testing med jevne mellomrom for å overvåke tilstanden og evaluere effektiviteten av behandlingen. For eksempel blir en serie bilirubin-tester utført for å overvåke nyfødt gulsott.

    Leverpanelet består av flere tester som utføres på samme blodprøve. Et typisk leverpanel består av følgende komponenter:

    • ALP er et enzym relatert til gallekanalene, og også produsert i bein, tarmer og under graviditet av morkaken. Øker ofte med blokkering av gallegangene.
    • ALT er et enzym som hovedsakelig befinner seg i leveren, det er det beste for å bestemme hepatitt.
    • AST er et enzym som finnes i leveren og noen andre organer, spesielt i hjertet og musklene i kroppen..
    • Bilirubin er et gallepigment produsert av leveren. En generell analyse av bilirubin måler den totale mengden i blodet, direkte bilirubin bestemmer den tilknyttede formen for bilirubin (i kombinasjon med andre komponenter) i leveren.
    • Albumin er det viktigste blodproteinet som produseres av leveren. Nivået påvirkes av funksjonen i leveren og nyrene. En reduksjon i nivået av albumin i blodet kan påvirkes av en nedgang i produksjonen av leveren, og en økning i produksjonen gjennom nyrene med urin i tilfelle av nedsatt funksjonsevne..
    • Totalt protein - Denne testen måler albumin og andre proteiner generelt, inkludert antistoffer som bekjemper infeksjoner..
    • AFP - utseendet til dette proteinet er assosiert med regenerering eller spredning (spredning av vev) av leverceller;

    Avhengig av retningen til den behandlende legen eller laboratoriet, er andre tester også inkludert i leverpanelet. Dette kan være bestemmelsen av protrombintid for å måle funksjonen til blodkoagulasjon. Siden mange enzymer involvert i koagulering produserer leveren, kan unormale verdier indikere skader på leveren..

    Med negative resultater blir tester av leverpanelet utført ikke en gang, men med bestemte tidsintervaller, som kan ta fra flere dager til uker. De må gjøres for å avgjøre om en reduksjon eller økning i verdiene er kronisk, og om det er behov for ytterligere analyser for å identifisere årsakene til leverdysfunksjon..

    SykdombilirubinALT og ASTALFalbuminProtrombintid
    Akutt leversykdom på grunn av infeksjon, giftstoffer eller medisiner osv..Norm eller høyereSterkt økte verdier (> 10 ganger). ALT er høyere enn ASTNormal verdi eller bare litt økt verdinormnorm
    Kroniske former for forskjellige leversykdommerNorm eller høyereLitt økte verdier. ALT har en konstant økt verdiNormal eller litt høyerenormnorm
    Alkoholisk hepatittNorm eller høyereAST er litt større; AST er dobbelt så mye som ALTNormal eller litt høyerenormnorm
    skrumpleverFørst høyere enn normalt, men synkende i de senere stadierAST er større enn ALT, men nivåene er lavere enn ved en sykdom forårsaket av alkoholisme, siden en ødelagt lever slutter å produsere dem.Normal eller litt høyereNorm eller mindreVanligvis over det normale
    Blokkering av gallegang, kolestaseNormale eller større, spesielt høye verdier når de er helt låstNorm eller litt til4 ganger høyere enn normaltVanligvis normal, men hvis sykdommen er kronisk, kan den være lavere enn normaltnorm
    Kreft som sprer levermetastasernormNorm eller litt tilSterkt økt verdinormnorm
    LeverkreftDet kan være en økt verdi, spesielt hvis sykdommen utvikler seg.AST er høyere enn ALTNorm eller høyereNorm eller mindreLenger enn normalt
    Autoimmune sykdommerNorm eller merlitt økt verdi; ALT er mer enn AST

    I stedet for leverpanelet kan legen også foreskrive et sammensatt stoffskiftepanel som del av en generell studie av pasientens tilstand. Den sørger for de fleste testene som er inkludert i leverpanelet, men inkluderer også andre tester som er nødvendige for å evaluere organer og systemer.

    Indikasjoner for analyse

    For at den behandlende legen skal bestemme behovet for en biokjemisk blodprøve på nivået av gamma-glutamyl transpeptidase, må følgende omstendigheter være til stede:

    • forberedende tiltak utføres før operasjonen (i dette tilfellet sender pasienten en detaljert biokjemisk blodprøve, i henhold til resultatene som GGT-indikatorene er fremhevet);
    • det er pålagt å utføre et utvalg av levervev for å utføre histologisk analyse eller andre forskningsmetoder;
    • pasienten klager over muskelsvakhet, konstant tretthet, manglende matlyst, bitterhet i munnen, smerter i høyre hypokondrium;
    • huden og hvite i øynene har fått en rik gul fargetone;
    • pasienten er for tiden under behandling for sykdommer i leveren, bukspyttkjertelen eller galleblæren;
    • det var en fullstendig avklaring av avføring, flytende avføring hersket og trang til toalettet skjer innen 1,5-2 timer etter å ha spist;
    • kvalme, oppkast og aversjon mot stekt og fet mat;
    • en endring i fargetonen på urin fra naturlig gul til mørk brun, noe som også indikerer levercellers død;
    • kløe i huden stopper ikke, og det er ingen andre tegn på en dermatologisk sykdom;
    • pasienten har allerede en samtidig sykdom i form av hepatitt, skleroserende kolangitt, skrumplever eller tumorskader på levervevet;
    • over lang tid overgrep en person hard brennevin, eller gjennomgår et behandlingsforløp for alkoholavhengighet (analyse utføres før behandling for å avgjøre hvor mye levervev som er skadet).

    En blodprøve for GGTP er obligatorisk for pasienter som klager på:

    • hyppige anfall av kvalme;
    • rikelig oppkast;
    • nedsatt eller fullstendig tap av matlyst;
    • følelse av trykk og smerter i høyre hypokondrium.

    En gastroenterolog eller nefrololog (for nyreproblemer) må sende pasienten for en blodprøve til nivået av gamma GT hvis det er mistanke om utvikling:

    • kolecystitt;
    • kolelithiasis (gallesteinsykdom);
    • kolestase;
    • cholangitis;
    • hepatitt C.

    Gjennomføring av denne analysen er også viktig for å bestemme årsakene til at pasienten hadde en prosess med stagnasjon av galle. Dette er med på å foreskrive riktig behandling og for å forhindre konsekvenser som er farlige for pasientens helse

    Analyse for gamma glutamyl transpeptidase må utføres for personer som lider av kronisk alkoholisme

    Under slike forhold er det viktig å nøyaktig bestemme graden av avhengighet av pasienten for etanol, samt å forstå hvor dårlig leveren påvirkes. Noen ganger hjelper det ikke bare å bevare en persons helse, men også å redde livet hans

    En blodprøve for GGTP er også indikert for:

    • utvikling av en allergi mot medisiner, som er ledsaget av generell ruspåvirkning av kroppen;
    • profylaktisk eller oppfølgende vurdering av leverens helse;
    • behovet for å evaluere funksjonen til leveren eller nyrene etter operasjonen.

    Men dette er ikke alle indikasjonene for å henvise pasienten til denne studien. GGT biokjemi utføres i tilfelle av:

    • blokkering av gallegangen;
    • tilstedeværelsen av mistenkelige formasjoner i bukspyttkjertelen;
    • nyreproblemer.

    Den høye nøyaktigheten og effektiviteten til å oppdage funksjonssvikt i viktige organer som leveren, bukspyttkjertelen og galleblæren gjør det mulig å bruke GGTP-verdiene når du kontrollerer for tilstedeværelsen av neoplasmer eller steiner i disse organene..

    Overvåking av ytelsen til dette enzymet i blodet gjør det mulig å evaluere ikke bare pasientens tilstand, men også effektiviteten av den terapeutiske behandlingen som brukes..

    Blant de viktigste indikasjonene for en glutamyltransferasetest er følgende:

    • rutinemessige forebyggende undersøkelser;
    • identifisere årsakene til smerter i høyre hypokondrium, oppkast, kvalme, stagnasjon av galle;
    • mistenkt hepatitt, kolecystitt, pankreatitt;
    • sannsynligheten for gallesteinsykdom;
    • undersøkelse av leveren;
    • før operasjonen;
    • vurdering av tilstanden til organer og systemer i tilfelle alkoholforgiftning eller rusmisbruk.

    Det Er Viktig Å Være Klar Over Vaskulitt