Gamma-glutamyltranspeptidase (gamma-GT)

Gamma-glutamyltranspeptidase er et enzym (protein) i leveren og bukspyttkjertelen, og aktiviteten i blodet øker med leversykdommer og alkoholmisbruk..

Gamma-glutamat transpeptidase, gamma-glutamate transferase, GGT, gamma-glutamate transpeptidase, gamma-glutamate transferase, GGTP.

Gamma-glutamyltransferase, Gamma-glutamyl transpeptidase, GGTP, Gamma GT, GTP.

Kinetisk kolorimetrisk metode.

Enhet / L (enhet per liter).

Hva biomateriale kan brukes til forskning?

Venøst ​​kapillærblod.

Hvordan forberede deg på studien?

  • Ikke spis i 12 timer før studien.
  • Eliminer fysisk og emosjonelt stress, og røyk ikke i 30 minutter før undersøkelsen.

Studieoversikt

Galle dannes i cellene i leveren og skilles ut av et system med mikrotubuli som kalles gallekanaler. De kombineres deretter i leverkanalene som strekker seg utover leveren og danner den vanlige gallegangen som strømmer inn i tynntarmen. Galle er nødvendig for absorpsjon av fett fra mat. Dessuten skilles noen medisinske stoffer gjennom galle. Det dannes konstant, men kommer inn i tarmen bare under og etter måltider. Når det ikke er nødvendig - akkumuleres i galleblæren.

Gamma-glutamyltranspeptidase er et enzym som finnes i cellene i leveren og galleveiene og er en katalysator for visse biokjemiske reaksjoner. Det er ikke inneholdt i blodomløpet, bare i celler, når innholdet deres ødelegges i ødeleggelsen. Normalt blir en del av cellene oppdatert, så en viss GGT-aktivitet blir oppdaget i blodet. Hvis mange celler dør, kan aktiviteten øke betydelig.

GGT-testen er den mest sensitive testen for stagnasjon av galle - kolestase. Aktiviteten til GGT når den hindrer utstrømningen av galle, for eksempel med steiner i gallegangene, øker tidligere enn aktiviteten til alkalisk fosfatase. Imidlertid er denne økningen uspesifikk, siden den forekommer i de fleste akutte sykdommer i lever og galleveier, for eksempel med akutt viral hepatitt eller kreft, og vanligvis er dette resultatet ikke veldig informativt når man etablerer en spesifikk sykdom eller tilstand som forårsaket leverskade.

I motsetning til andre leverenzymer, blir produksjonen av GGT "utløst" av alkohol, og derfor hos personer som misbruker den, kan dens aktivitet økes selv i fravær av leversykdom. I tillegg stimuleres produksjonen av GGT av visse medikamenter, inkludert fenobarbital og paracetamol, derfor kan det på bakgrunn av inntaket deres forventes en økning i GGT uten leverskader.

GGT finnes også i nyrer, milt, bukspyttkjertel, hjerne, prostata, og en økning i aktiviteten er ikke spesifikk bare for leversykdommer.

Hva brukes studien til??

  • For å bekrefte sykdommen i lever- og gallegangene, spesielt hvis det er mistanke om blokkering av galleveiene med steiner i gallegangene eller med en tumor i bukspyttkjertelen.
  • For å overvåke effektiviteten av behandlingen for alkoholisme eller alkoholisk hepatitt.
  • For diagnostisering av sykdommer som påvirker galleveiene - primær gallesirrose og primær skleroserende kolangitt.
  • For å bestemme hva som forårsaker en økning i alkalisk fosfataseaktivitet, leversykdom eller beinpatologi.
  • For å overvåke tilstanden til pasienter med sykdommer der GGT er forhøyet, eller for å evaluere effektiviteten av deres behandling.

Når en studie er planlagt?

  • Når du utfører standard diagnostiske paneler som kan brukes under rutinemessige medisinske undersøkelser, som forberedelse til kirurgi.
  • Når du utfører "leverprøver" brukt til å evaluere leverfunksjon.
  • Ved klager på svakhet, tretthet, tap av matlyst, kvalme, oppkast, magesmerter (spesielt i høyre hypokondrium), gulsott, mørk urin eller avføring i avføring, kløe i huden.
  • Ved mistanke om alkoholmisbruk eller når pasienter som er under behandling for alkoholisme eller alkoholisk hepatitt, overvåkes.

Hva betyr resultatene??

Alder, kjønn

Referanseverdier

Oftest er følgende uttalelse sant: jo høyere aktivitet GGT er, jo mer alvorlig skade på leveren eller galleveiene.

Årsaker til økt GGT-aktivitet

  • Skader på lever og galleveier
    • Obstruktiv gulsott assosiert med hindring av gallegangen.
      • Gallekanalesteiner, gallegangssår etter operasjonen.
      • Svulster i gallegang.
      • Kreft i bukspyttkjertelen, magekreft ved mekanisk komprimering av den vanlige gallegangen gjennom hvilken galle kommer inn i tolvfingertarmen.
    • Alkoholisme. Etter å ha nektet alkohol, går GGT-aktiviteten tilbake til det normale etter en måned. Selv om en tredjedel av alkoholikere har normal GGT-aktivitet.
    • Leverkreft, metastaser av svulster i andre organer i leveren.
    • Levercirrhosis er en patologisk prosess der det normale levervevet erstattes av cicatricial, som hemmer alle leverfunksjoner.
    • Akutt og kronisk hepatitt av hvilken som helst opprinnelse, spesielt alkohol.
    • Smittsom mononukleose. Dette er en akutt virusinfeksjon, som vanligvis manifesteres av feber, betennelse i svelget og hovne lymfeknuter. I dette tilfellet er leveren ofte involvert i den patologiske prosessen.
    • Primær gallecirrhose og primær skleroserende kolangitt er sjeldne sykdommer som forekommer hos voksne og er assosiert med autoimmun skade på gallegangene. Ledsaget av ekstremt høy aktivitet av GGT og alkalisk fosfatase.
  • Andre grunner
    • Pankreatitt er en akutt betennelse i bukspyttkjertelen. Ofte utløst av alkoholforgiftning..
    • Prostatakreft.
    • Bryst- og lungekreft med levermetastaser.
    • Systemic lupus erythematosus - en sykdom der det produseres antistoffer mot deres eget vev.
    • Hjerteinfarkt. I det akutte stadiet av hjerteinfarkt forblir GGT-aktivitet vanligvis normal, men kan øke etter 3-4 dager, noe som reflekterer sekundær leverinvolvering på grunn av hjertesvikt.
    • Hjertefeil.
    • Hyperthyreoidisme - økt funksjon i skjoldbruskkjertelen.
    • diabetes.

Årsaker til redusert GGT-aktivitet

  • Hypothyreoidisme - en tilstand der skjoldbruskfunksjonen er redusert.

Hva kan påvirke resultatet?

  • GGT-aktivitet økes i overvekt.
  • Aspirin, paracetamol, fenobarbital, statiner (medisiner som senker kolesterolet), antibiotika, histaminblokkere (brukes til å redusere sekresjonen av magesaft), soppdrepende medisiner, antidepressiva, p-piller, testosteron og flere andre medisiner kan øke aktiviteten til GGT.
  • Langvarig inntak av askorbinsyre kan føre til en nedgang i aktiviteten til GGT.

I beinpatologi forblir GGT-aktivitet, i motsetning til alkalisk fosfatase, normal, så vel som under tilstander assosiert med beinvekst, under graviditet og nyresvikt..

Hvem foreskriver studien?

Allmennlege, terapeut, gastroenterolog, spesialist i smittsomme sykdommer, hematolog, endokrinolog, kirurg.

GGT i den biokjemiske analysen av blod økes. Hva betyr dette, normen hos kvinner, menn, barn, behandling

En økning i GGT i den biokjemiske sammensetningen av blod kan indikere farlige leversykdommer som skrumplever, hepatitt, rus eller virusetiologi. En økning i GGT-normen forekommer hos mennesker som misbruker sprit i flere dager, uker og måneder..

Hva er GGT

GGT (gamma-glutamyl transpeptidase) i den biokjemiske sammensetningen av blodet er et proteinenzym, en økning som indikerer en smertefull tilstand i leveren eller galleblæren vev. Det er cellene i disse indre organene som inneholder fordøyelsesenzymet.

I henhold til dets fysiologiske formål er GGT et biokjemisk stoff som sammen med galle akselererer nedbrytningen av fett som kommer inn i kroppen som en del av mat.

Hos friske mennesker som ikke har samtidig sykdommer i leveren eller galleblæren, er gamma-glutamyl transpeptidase i blodet helt fraværende, eller nivået er ubetydelig.

Hvis en person lider av patologier i disse organene, dør cellene deres, som et resultat av at GGT-molekyler kommer i blodet.

Etter en biokjemisk blodprøve oppdages en økt konsentrasjon av protein-enzymet, noe som indikerer behovet for en grundigere undersøkelse av pasienten.

Indikasjoner for analyse

For at den behandlende legen skal bestemme behovet for en biokjemisk blodprøve på nivået av gamma-glutamyl transpeptidase, må følgende omstendigheter være til stede:

  • forberedende tiltak utføres før operasjonen (i dette tilfellet sender pasienten en detaljert biokjemisk blodprøve, i henhold til resultatene som GGT-indikatorene er fremhevet);
  • det er pålagt å utføre et utvalg av levervev for å utføre histologisk analyse eller andre forskningsmetoder;
  • pasienten klager over muskelsvakhet, konstant tretthet, manglende matlyst, bitterhet i munnen, smerter i høyre hypokondrium;
  • huden og hvite i øynene har fått en rik gul fargetone;
  • pasienten er for tiden under behandling for sykdommer i leveren, bukspyttkjertelen eller galleblæren;
  • det var en fullstendig avklaring av avføring, flytende avføring hersket og trang til toalettet skjer innen 1,5-2 timer etter å ha spist;
  • kvalme, oppkast og aversjon mot stekt og fet mat;
  • en endring i fargetonen på urin fra naturlig gul til mørk brun, noe som også indikerer levercellers død;
  • kløe i huden stopper ikke, og det er ingen andre tegn på en dermatologisk sykdom;
  • pasienten har allerede en samtidig sykdom i form av hepatitt, skleroserende kolangitt, skrumplever eller tumorskader på levervevet;
  • over lang tid overgrep en person hard brennevin, eller gjennomgår et behandlingsforløp for alkoholavhengighet (analyse utføres før behandling for å avgjøre hvor mye levervev som er skadet).

GGT i den biokjemiske sammensetningen av blod økes i de tilfellene når også galleblæren dysfunksjoner er til stede. Derfor er pasienter som lider av sykdommer i dette organet også vist å bli testet for gamma-glutamyl transpeptidase i blodomløpet.

Hvordan forberede deg på bloddonasjon

For å få de mest pålitelige dataene uten å forvrenge resultatene av analysen, er det nødvendig å overholde regler for forberedelse til bloddonasjon. De består i følgende handlinger fra den personen som skal gjennomgå en laboratorieundersøkelse:

  • i løpet av de siste 12 timene før levering av biologisk materiale ikke spiser mat (det er lov å drikke bare ett vann, men i små volum);
  • 2 dager før bloddonasjon, utelukk fysisk aktivitet forbundet med løping i korte og lange avstander, løfting av vekter, knebøy, bruk musklene i bukhulen;
  • 24 timer før undersøkelsen må du forhindre psyko-emosjonell overbelastning, stress og konfliktsituasjoner (personen skal være i et gunstig miljø, omgitt av nære og vennlige mennesker);
  • i løpet av de siste 30 minuttene før blodprøvetaking, må du ikke røyke eller ta medisiner som inneholder nikotin (dette gjelder spesielt menn og kvinner som prøver å kvitte seg med avhengighet og bruke substitusjonsbehandling);
  • 5 dager før testen, ikke drikk alkohol, siden alkohol kan provosere kraftig død av leverceller, noe som betyr at en overdreven mengde GGT-enzym kommer i blodet.

I alle stadier av forberedelser for bloddonasjon for sin biokjemiske undersøkelse av gamma-glutamyl transpeptidase, anbefales det å utelukke røkt, fet, syltede matvarer fra kostholdet for ikke å skape en økt belastning på levervevet.

Menyen til personen som undersøkes skal bestå av korn, grønnsaker, melkesyreprodukter, kokte poteter og magert kjøtt (kylling, kalkun, kanin, kalvekjøtt).

Hvordan er analysen på GGT

GGT i den biokjemiske sammensetningen av blod økes eller dens normale indekser opprettholdes, bestemmer en detaljert laboratoriestudie.

Det utføres som følger:

  • en spesialist i det biokjemiske laboratoriet utfører en prøvetaking av venøst ​​blod fra et kar som befinner seg i området av albueleddet (for analyse vil det være nødvendig med 10 til 20 ml biologisk materiale);
  • pasienten får behandling av såroverflaten på stedet for hudpunksjon;
  • det innsamlede blodet blir sendt til sterile laboratorieforhold for analyse;
  • i prosessen med å bestemme nivået av gamma-glutamyltranseptidase i blodet, brukes kjemiske reagenser for å isolere et proteinenzym av denne typen, så vel som automatiske analysatorer av medisinsk utstyr;
  • etter fullført diagnose mottar laboratorieassistenten omfattende informasjon om den biokjemiske sammensetningen av blodet og nivået av GGT.

Gjennomsnittlig varighet av studien er fra 1 til 2 timer. Tilstedeværelsen av moderne elektroniske apparater og laboratorieutstyr akselererer analyseprosessen..

Hvis det er den minste mistanke om forvrengning av undersøkelsesresultatene, kan den behandlende legen foreskrive en ny prøvetaking av biologisk materiale med frigjøring av konsentrasjonen av GGT. Målingen utføres i enheter med hensyn til 1 liter venøst ​​blod..

Norm GGT i analyse av blod for biokjemi

Indikatorer for nivået av gamma-glutamyltranspeptidase i blodomløpet avhenger av pasientens alder, samt kjønn. Nedenfor er en detaljert tabell som viser normene til proteinenzymet for pasienter i den tilsvarende alderskategorien.

Alder og kjønnNormindikatorer (ikke mer enn den angitte enheten / L)
Baby født for 5 dager siden185
Fra 5 dager til 6 måneder.204
Fra 6 til 12 måneder.34
1 til 3 åratten
Fra 3 til 6 år23
6 til 12 år gammel17
Ung mann fra 12 til 17 år gammel45
Tenåringsjente fra 12 til 17 år gammel33
Mann 18 år eller eldre10 til 71
Kvinne 18 år og eldre6 til 42

GGT i den biokjemiske sammensetningen av blod er forhøyet hos voksne og små barn som har alvorlige former for skade på levervevet, galleblæren og dets kanaler..

Etter å ha mottatt resultatene fra en laboratorieundersøkelse, som indikerer et overskudd av konsentrasjonen av dette protein-enzymet, foreskriver den behandlende legen pasienten å gjennomgå ytterligere diagnostikk av de ovennevnte indre organene.

Årsaker til økt GGT i blodet

Det er et stort antall sykdommer og faktorer, hvis tilstedeværelse provoserer en økning i konsentrasjonen av gamma-glutamyltranseptidase. Alle av dem medfører skade på levervevets, bukspyttkjertelen, veggene i galleblæren, mage, nemlig:

  • hindring av gallegangene, som oppsto i forbindelse med utvikling av mekanisk gulsott;
  • en svulst i mageveggen, som komprimerer galleblæren og dens kanaler, og forstyrrer deres normale drift;

Kronisk drikking øker GGT i blodkjemi

  • kronisk alkoholisme (etter fullstendig avvisning av alkoholholdige drikker, kan en økt konsentrasjon av GGT i blodomløpet vedvare i ytterligere en måned, selv om 30% av personene skilte ut proteinenzym 3 ganger raskere);
  • steiner i galleblæren og kanalene;
  • kirurgisk inngrep i leveren, magen, galleblæren, bukspyttkjertelen;
  • kolangitt i skleroserende type, så vel som galle-skrumplever (det spiller ingen rolle hvilke faktorer som forårsaket massedød av leverceller);
  • smittsom mononukleose som foregår i en komplisert form (leveren og milten er involvert i den inflammatoriske prosessen forårsaket av den virale mikroorganismen, derfor en økning i disse organene i volum, samt skade på vevet deres);
  • onkologisk neoplasma i hodet av bukspyttkjertelen;
  • akutt eller kronisk hepatitt, som har rus (eksponering for kjemikalier med giftig etiologi), alkoholholdig eller viral opprinnelse (denne patologien er preget av de høyeste nivåene av GGT, så vel som en kraftig bølge i alkaliske fosfataseforbindelser);
  • pankreatitt forårsaket av forgiftning med alkohol, eller ervervet gjennom hele livet på grunn av de negative effektene av andre faktorer;
  • kronisk hjertesvikt;
  • lupus erythematosus (en farlig systemisk sykdom under utviklingen av hvilken menneskets immunitet begynner å produsere spesifikke antistoffer i forhold til dets eget vev i indre organer);
  • hypertyreose i skjoldbruskkjertelen, når den begynner å syntetisere et stort antall hormoner som forstyrrer leveren;
  • en kreft i lungene eller kjertelvevet i brystet, hvis metastaser har spredd seg til leveren;
  • hjerteinfarkt (en økning i GGT-nivåer observeres 3-4 dager etter anfallet, fordi leverens belastning øker på grunn av hjertefunksjon);
  • diabetes.
  • GGT i den biokjemiske sammensetningen i blodet økes til den behandlende legen undersøker pasienten, fastslår den sanne årsaken til den høye konsentrasjonen av proteinenzymet og tar tiltak for å redusere nivået av gamma-glutamyltranseptidase.

    Rettidig start av behandling for en påvist sykdom gjør det mulig å undertrykke ytterligere ødeleggelse av leverceller og bringe den biokjemiske sammensetningen av blod til normal.

    Er en økning i GGT livsfarlig??

    En økt konsentrasjon av gamma-glutamyltranspeptidase i blodet er ikke farlig for helse og liv. Trusselen kommer fra sykdommer som utløste en økning i nivået av proteinenzym. De fleste av patologiene er listet opp i avsnittet ovenfor, og kan føre til et langvarig fordøyelses- og endokrine systemopprør..

    I tillegg kan mangel på behandling for sykdommer som hepatitt, skrumplever, pankreatitt, onkologiske prosesser i vev i magen, leveren, bukspyttkjertelen, galleblæren og dens kanaler føre til død.

    Måter å senke GGT-nivåer i blodet

    Det må forstås at å øke konsentrasjonen av gamma-glutamyl transpeptidase i blodet ikke er en sykdom, men et av de mange symptomene som indikerer hovedpatologien. For å redusere nivået av GGT anbefales det derfor å starte behandling av hovedsykdommen så snart som mulig.

    Hvis det haster med å redusere metningen av enzymproteinet, kan denne effekten oppnås ved å ta følgende medisiner:

    • Acetylsalisylsyre;
    • Paracetamol;
    • Vitamin C.

    Dosering og varighet av terapi bestemmes individuelt, basert på det kliniske bildet av sykdomsforløpet. I de fleste tilfeller er det ikke nødvendig å ta medisiner som senker konsentrasjonen av GGT i blodet. Det er nok å starte behandlingen av sykdommen som forårsaket den massive døden av leverceller, slik at indikatorene for den biokjemiske sammensetningen av blodet i løpet av 1-3 dager kom tilbake til normal.

    GGT-reduksjon folkemessige rettsmidler

    Alternativ medisin tilbyr sine egne alternative metoder for å redusere konsentrasjonen av leverenzymet. For disse formål brukes avkok og tinkturer av medisinplanter. Nedenfor er noen få folkeoppskrifter som kan forbedre funksjonen til leveren, galleblæren og bukspyttkjertelen, slik at cellene ødelegges:

    • grave 5 løvetann rhizomer, vask dem under rennende vann. Finhakk med en kniv, hell i en metallbeholder, og hell deretter 1,5 liter kokende vann (beholderen er dekket med et lokk og la den trekke i 1 time). Etter avkjøling tas massen ved 250 g 2 ganger om dagen i 15 minutter. før måltid. Varigheten av terapien er 5-7 dager;
    • ta 2 ss. l tørket plante Astragalus og hell dem i en panne, hell deretter 1 liter rennende vann, sett på en gasskomfyr, hvor det koker i 15 minutter. (den resulterende buljongen drikkes 100 g 3 ganger om dagen i 10 minutter før et måltid med en behandlingsvarighet på 10-12 dager);
    • hell 3 ss i en metallbeholder l tørkede rosebær, hell 2 liter vann i dem og la det småkoke over svak varme i 20 minutter, og ved avslutningen av kokeprosessen, bruk dem som vanlig stuet frukt i ubegrensede mengder (dette avkoket har naturlige vanndrivende og koleretiske egenskaper, og hjelper også til med å gjenopprette leverceller);
    • ta 15 g tørket melk tistel plante, hell det med 1 liter kokende vann, pakk beholderen med en tett ullklut eller et håndkle, la medisinen tilføres i 2 timer (ta 150 ml om morgenen og kvelden 10 minutter før måltidet).

    Før du forsøker å uavhengig redusere konsentrasjonen av GGT i blodet ved bruk av tradisjonell medisin, anbefales det at du først besøker en allmennlege, gjennomgår en undersøkelse, og bare med hans tillatelse til å begynne behandling med medisinplanter.

    Hva er grunnen til å senke frekvensen av GGT

    Konsentrasjonen av gamma-glutamyl transpeptidase kan ikke bare økes, men også reduseres.

    En lignende endring i den biokjemiske sammensetningen av blod er mulig i følgende tilfeller:

    • hypotyreose - en sykdom i nærvær av aktiviteten i skjoldbruskkjertelvev er redusert, noe som medfører en hormonell ubalanse;
    • ekstrem grad av overvekt;
    • langvarig bruk av fenobarbital eller askorbinsyre;
    • onkologiske sykdommer i beinvev;
    • graviditetstilstand;
    • Kronisk nyresvikt.

    En spesiell økning i nivået av GGT i den biokjemiske sammensetningen av blodet er ikke nødvendig. Pasienten og den behandlende legen har til oppgave å behandle den underliggende sykdommen, hvis eliminering vil gjenopprette den normale funksjonen til leveren og andre indre organer som er involvert i fordøyelsesprosessen..

    Artikkeldesign: Mila Fridan

    Video om GGT i blodet

    Elena Malysheva vil snakke om normen og årsakene til avvisning av GGT:

    9 grunner til å øke nivået av gamma-glutamyltransferase i blodet

    Ulike forbindelser inne i cellene i kroppen vår kan hjelpe til med diagnostisering av en rekke sykdommer. Så for eksempel kan leverenzymer indikere en patologi av dette organet hvis nivået i blodet stiger. En av dem er gamma glutamyl transferase (GGTP). Det vil bli sortert ut hva slags enzym det er, under hvilke spesifikke forhold det stiger i blodet.

    GGTP - hva slags forbindelse er det og hvilke funksjoner utfører den

    Hva er det?

    GGTP står for gamma-glutamyl transpeptidase. Noen ganger kaller denne indikatoren GGT, som står for gamma-glutamyltransferase. Begge disse navnene refererer til det samme enzymet..

    Hvor blir dannet

    Dette enzymet kan finnes i tubulene i nyrenephronen, i epitelet som fôrer gallegangene. Det meste finnes i leverceller. Derfor, når disse vevene er skadet, kommer enzymet inn i blodomløpet, noe som gjør at legen kan diagnostisere en funksjonssvikt i disse organene.

    Hovedfunksjoner

    Glutamyltransferase er et enzym. Og enzymets viktigste rolle er å katalysere en reaksjon. GGT katalyserer reaksjonene ved glutamyloverføring til en aminosyre eller andre forbindelser. Denne overføringen er veldig viktig i utvekslingen av aminosyrer: enzymet fremmer deres transport, for eksempel gjennom tarmveggen fra dens lumen til blodet.

    Når det utnevnes en analyse for å bestemme GGTP?

    Definisjonen av denne typen transferase kan tilordnes separat eller i kombinasjon med andre leverenzymer, for eksempel aspartataminotransferase eller alaninaminotransferase for diagnostisering av tilstanden i levervekten..

    Glutamyltranspeptidaseaktiviteten øker også når giftige stoffer, som visse medikamenter eller alkohol, blir utsatt for leveren. Så du kan forstå om leverskader var forårsaket av alkohol eller ikke..

    Glutamyltransferase finnes ikke i bein. Følgelig vil ikke benvevs patologi påvirke nivået av GGT. Dette lar deg søke etter grunner til å øke et annet enzym - alkalisk fosfatase.

    GGT lar deg også vurdere nyrenes tilstand, og i tilfelle brudd på arbeidet deres, vil dette enzymet fortelle legen om det.

    Dermed muliggjør gamma-glutamyltransferase den differensielle diagnosen tilstander som forårsaker nedsatt leverfunksjon, patologi i nyrene og galleveiene.

    Analyse forberedelse

    Hvordan forberede?

    Definisjonen av gamma-glutamyltransferase refererer til en rekke biokjemiske blodprøver. For å få nøyaktig informasjon om GGT i kroppen, må pasienten på riktig måte forberede seg til bloddonasjon.

    Forberedelsesreglene er veldig enkle:

    • for biokjemiske studier, bør blod tas på tom mage, det vil si etter nattlig faste i 10 til 12 timer. Så du kan være sikker på at blodet vil være egnet for forskning og vil gjenspeile det nøyaktige innholdet av testparameteren i blodet;
    • Det anbefales å ikke røyke i flere timer før blodprøvetaking;
    • emosjonelle opplevelser dagen før analysen kan påvirke nøyaktigheten av resultatene fra studien;
    • trening og annen fysisk overbelastning av kroppen bør avskaffes. De kan også påvirke sluttresultatet;
    • Hvis medisiner er foreskrevet til pasienten, må du oppsøke lege - kan de påvirke nivået av enzymet i blodet? Pasienten skal ikke avlyse noe og utnevne seg!

    Hvor du skal gi opp?

    Blodprøvetaking for å bestemme nivået av glutamyltransferase skjer på et spesialkontor på en medisinsk institusjon. Oftest er det en klinikk på bostedet. Denne enkle analysen kan utføres i private medisinske organisasjoner..

    Når du kontakter klinikken på bostedet, er bestemmelsen av gamma-glutamyltransferase gratis for pasienter med en obligatorisk medisinsk forsikring. Hvis pasienten uttrykte et ønske om å donere blod for å bestemme nivået av dette enzymet i et privat medisinsk senter, vil prisen for denne analysen være rundt 150 - 300 rubler.

    Husk at en ekstra avgift belastes for selve blodprøvetakingsprosedyren. I gjennomsnitt vil dette være omtrent 150 - 300 rubler, avhengig av regionen.

    Dekryptering av analyse

    Norm for menn og kvinner

    Grensene for normale gamma-glutamyltransferase-nivåer er forskjellige for menn og kvinner. Normen for kvinner er ikke mer enn 30 enheter per liter (U / L), og for menn - ikke mer enn 50.

    I tillegg ble det kun gitt indikative standarder for GSTP. I hvert laboratorium kan standardene variere avhengig av hvilke testsystemer som brukes for å bestemme aktiviteten til dette enzymet i blodserum..

    Gitt dette gjøres en studie av nivået av GGT i dynamikk best i det samme kliniske diagnostiske laboratoriet.

    Normer hos barn

    Normale nivåer av GGT hos barn er høyere enn hos voksne og varierer avhengig av barnets alder.

    I den første uken av et barns liv bør nivået av GGTP ikke overstige 180 enheter per liter. Da kan enzymnivået øke, men ikke mer enn 200 enheter i løpet av første halvår.

    Ved det første året av et barns liv reduseres nivået av gamma-glutamyltransferase til et nivå på ikke mer enn 35 enheter per liter. Under veksten og livet til barnet endrer nivået av glutamyltransferase ikke mye. Fra rundt tolvårsalderen blir normale enzymnivåer de samme som for en voksen.

    Avvik fra normen

    En endring i aktiviteten til enzymet glutamyltransferase mer enn referanseverdier indikerer patologi. I tillegg til sykdommer, kan medisiner føre til et avvik fra normen, men mer om det senere.

    Noe som fører til en økning i GGTP?

    Det er en rekke patologier i leveren og galleveiene, som er ledsaget av økt aktivitet av gamma-glutamyl transpeptidase. Disse inkluderer:

    • brudd på utstrømningen av galle gjennom kanalene på grunn av blokkering av lumen av en stein, en svulst, som forårsaker utvikling av mekanisk (hindrende eller subhepatisk) gulsott hos en pasient;
    • leverskade forårsaket av virkningen av alkohol, for eksempel hepatitt;
    • erstatning av bindevev, som kalles skrumplever;
    • pankreatitt - betennelse i bukspyttkjertelen;
    • autoimmun skade på leveren og gallegangene;
    • diabetes;
    • leverskade med smittsom mononukleose;
    • leverkreft;
    • nyrepatologi, for eksempel kronisk nyresvikt.

    Rettelsesmetoder

    Bare en lege kan korrigere nivåer av gamma-glutamyltransferase. Etter å ha analysert dataene til andre resultater av analysen, vil han kunne finne ut årsaken og utføre kompetent behandling av den primære sykdommen. Etter helbredelse vil nivået på enzymet gå tilbake til normalt..

    For eksempel, hvis den økte aktiviteten til GGT er forårsaket av høyt alkoholforbruk, vil enzymnivået gå tilbake til normalt når du stopper bruken..

    Hva kan føre til bedre resultater foruten sykdommer?

    Unormale resultater av gamma-glutamyltransferase-nivåer kan være et resultat av alkoholmisbruk før dagen til en blodprøve. Det ble også nevnt tidligere at noen medikamenter kan påvirke resultatene av studien og overdrive de virkelige verdiene..

    Disse medisinene inkluderer:

    • barbiturater,
    • statiner - en gruppe medikamenter som brukes til å senke kolesterolet i blodet;
    • antidepressiva;
    • noen typer antibiotika;
    • p-piller og noen andre hormonelle medisiner;
    • Aspirin, Paracetamol.

    Det er også bemerket det faktum at hos overvektige individer nivået av enzymet vil være høyere enn normalt. Dette bør legen ta hensyn til når han tolker resultatene av studien..

    Konklusjon

    Gamma-glutamyltransferase er en viktig diagnostisk indikator. Dette enzymet lar deg diagnostisere lesjoner i leveren, galleveiene og nyrefunksjonen. GGT er en sensitiv indikator, derfor er det viktig å forberede deg på riktig måte.

    Vi gjorde mye for at du kan lese denne artikkelen, og vi vil være glad for tilbakemeldingene dine i form av en vurdering. Forfatteren vil være glad for å se at du var interessert i dette materialet. takke!

    GGT-indekser i biokjemisk blodanalyse

    Funksjoner av gamma-glutamyltransferase (GGT)

    Enzymlokalisering - intracellulær

    Gamma-glutamyltransferase er et enzym som finnes i cellene i de fleste organer i menneskekroppen: nyrer, lever, bukspyttkjertel, hjerte, milt, tarmer, muskler. I blodet er GGT inneholdt i relativt små mengder, hundrevis av ganger mindre enn inne i cellene i disse organene.

    GGT er en del av cellemembraner (membraner), så vel som i lysosomer, mikrosomer og andre strukturelle elementer; enzymet kommer inn i blodomløpet etter død eller skade på cellen. Hver dag dør et stort antall gamle celler naturlig, de erstattes av nye, GGT er konstant til stede i små mengder i blodet på grunn av denne normale prosessen.

    GGT utfører hovedfunksjonene sine inne i cellene:

    • Det hjelper til med å transportere aminosyrer (proteinbestanddeler) gjennom cellemembraner - uten enzymet vil ikke de viktigste "bygnings" -elementene komme inn i cellen;
    • Deltar i metabolismen av leukotrienes - spesielle stoffer som er ansvarlige for det normale løpet av den inflammatoriske reaksjonen i kroppen;
    • Deltar i glutation-syklusen av biokjemiske reaksjoner, og hjelper til med å nøytralisere forbindelser som er skadelige for kroppen.

    Normale enzymverdier

    Normens grenser avhenger av metodikken for å bestemme nivået av GGT

    Normale verdier av konsentrasjonen av GGT i blodet varierer avhengig av teknikken som analysen ble utført med. I laboratorier brukes spesielle sett med kjemiske reagenser (testsystemer) som har forskjellig følsomhet og spesifisitet, og derfor bør du, når du evaluerer resultatet, fokusere på de normale verdiene som er angitt i laboratorieformen..

    I gjennomsnitt er GGT-graden for voksne:

    • Menn (17 år og eldre): 10-34 IE / L;
    • Kvinner (17 år og eldre): 9-22 IE / L.

    For barn er ikke normene forskjellige etter kjønn før ungdomstiden:

    • Nyfødte (opptil 5 dager): mindre enn 185 IE / l;
    • Spedbarn opp til seks måneder: mindre enn 204 IE / l;
    • Barn opp til et år: mindre enn 34 IE / l;
    • Barn fra ett til tre år: mindre enn 18 IE / l;
    • Førskolebarn 4-6 år: mindre enn 23 IE / l;
    • Ungdomsskolebarn 7-12 år: mindre enn 17 IE / l;
    • Tenåringsjenter under 17 år: mindre enn 33 IE / L;
    • Tenåringsgutter under 17 år: Mindre enn 45 IE / L.

    Årsaker til enzymnivåer

    Årsaker til høy GGT - prostatakreft

    GGT øker med massiv skade eller død av celler i organene som inneholder den i størst mulig mengde. Dette observeres med en rekke sykdommer i leveren, nyrene, bukspyttkjertelen:

    1. Cholecystocholangitis;
    2. Gallesteinsykdom;
    3. Steiner i de intrahepatiske kanalene;
    4. Skrumplever i leveren;
    5. Viral hepatitt B, C;
    6. Akutt giftig leverskade (kjemikalier, giftstoffer, alkohol);
    7. Kronisk og akutt medikamentell hepatitt;
    8. Svulster i leveren, nyrene, bukspyttkjertelen eller andre organer i bukhulen, noe som fører til kompresjon av gallegangen;
    9. Prostatakreft;
    10. Nyresykdom (glomerulonefritt, smittsom pyelonefritt);
    11. Bukspyttkjertelsykdom (akutt eller kronisk pankreatitt);
    12. Alkoholisme og rus.

    Årsaker til en nedgang i GGT

    Skjoldbrusk-patologi kan forårsake en reduksjon i GGT

    Det er ikke mange grunner til å senke GGT, det skyldes hovedsakelig endokrinologisk patologi i skjoldbruskkjertelen:

    1. Medfødt underutvikling av "skjoldbruskkjertelen";
    2. Arvelig brudd på syntesen av skjoldbruskhormoner;
    3. Autoimmune sykdommer i skjoldbruskkjertelen assosiert med en reduksjon i dens funksjon (hypotyreose);
    4. Tilstander etter operasjon i skjoldbruskkjertelen;
    5. Mangel på jod i maten.

    Hva er de farlige avvikene fra enzymet fra normen

    Avvik i analysen - en anledning til videre undersøkelse av pasienten

    Høye GGT-verdier indikerer nesten alltid alvorlig skade på et av de indre organene (oftest leveren, nyrene), og jo høyere indikatoren er, desto mer alvorlig er tilstanden.

    I tilfelle når GGT er høyt hos en relativt sunn person, kan dette være et bevis på en latent smittsom prosess (viral hepatitt), som bare forverres hvis den ikke er behandlet. Hvis det er symptomer på sykdommen, indikerer en økning i GGT en mulig involvering av leveren i den patologiske prosessen. Oftere forverres andre testresultater: alkalisk fosfatase, ALT, AST, bilirubin (totalt og bundet), de såkalte "leverprøvene".

    Indikasjoner og forberedelse til studien

    Forstyrrelser i fordøyelsessystemet - indikasjon for analyse

    Studien er foreskrevet for å overvåke helsetilstanden og effektiviteten av behandlingen hos pasienter:

    • Kroniske leversykdommer (hepatitt av smittsom og ikke-smittsom art, skrumplever, steatose, gallesteinsykdom, kolangitt);
    • Sykdommer i nyrene og blæren (kronisk blærekatarr, pyelonefritt);
    • Gastrointestinale sykdommer (enzymatisk mangel, pankreatitt).

    Analysen brukes også til å overvåke gjenoppretting av kroppen etter hjerteinfarkt, siden GGT-hastigheten stiger betydelig 2-3 dager etter angrepet. Enzymet i blodet avtar gradvis med restaurering av funksjonen til hjertemuskelen, som lar deg bruke det som et av kriteriene for å forutsi.

    Fordøyelsessykdommer - indikasjon for forskning

    For personer som ikke har en etablert diagnose, er det viktig å bestemme GGT om følgende symptomer vises:

    • Gulfarging av huden og proteinene i øynene, håndflatene;
    • Endring i normal farge på urin til mørkere, avføring til lys;
    • Utseendet til smerter i magen, ryggen;
    • Tyngde etter å ha spist;
    • Dårlig smak i munnen, endring i smakssensitivitet;
    • Kvalme, oppkast etter å ha spist.

    Forberedelsene til studien bør omfatte å gi opp alkohol 2-3 dager før studien (eliminerer en tilfeldig faktor som betydelig påvirker resultatene), minst en time før bloddonasjonen, kan du ikke røyke. Analysen er gitt på tom mage, helst morgentid opp til 11 timer. Det siste måltidet på kvelden skal være enkelt, overspising er utelukket.

    Å dechiffrere resultatene av studien

    Riktig tolkning av resultatene bestemmer det videre hendelsesforløpet.

    Resultatene fra studien presenteres alltid i numerisk form, for eksempel: "GGT - 20 IE / l." Resultatskjemaet gir en rekke normale verdier for mennesker i forskjellige aldre; når man tolker resultatene, bør disse tallene brukes. Alle verdier som overskrider den øvre grensen anses som forhøyede og kan indikere en eksisterende sykdom..

    Noen ganger er ikke den nedre (minste) terskelverdien til normen angitt i formen, i dette tilfellet kan ikke GGT-resultater under normen oppdages. Dette skyldes funksjonene i metoden som brukes i et bestemt laboratorium..

    Resultatene fra analysen indikerer alltid konsentrasjonsenheter av GGT, oftest kan det være ME / L (internasjonale enheter i en liter) eller U / ml (konvensjonelle enheter i en milliliter). Begge analysetyper er like nøyaktige, men skal bare tolkes i henhold til tabeller med normale verdier for spesifikke måleenheter..

    Hva kan påvirke resultatet.

    Mangel på jod i kostholdet kan påvirke testresultatene

    Nøyaktigheten av resultatet påvirkes negativt av:

    • Overspising (spesielt fet mat) et døgn før du gir blod;
    • røyking;
    • Alkoholbruk (unntatt når det er nødvendig å identifisere alkoholavhengighet);
    • Tar visse medisiner (prevensjonsmidler, østrogener, kefalosporiner, barbiturater);
    • Mangel på jod i maten.

    Korrigering av enzymnivå

    Korreksjonsmetoden bestemmes av legen

    Med et redusert nivå av GGT er ytterligere diagnose av skjoldbruskfunksjon, bestemmelse av nivåene av hormoner T3, T4 og TSH nødvendig. Hvis patologien ikke kunne identifiseres, oftest er det bare nødvendig å øke inntaket av sporstoffer med mat, kan dette oppnås ved å spise:

    • Havkål;
    • Sjømat (blåskjell, blekksprut, reker);
    • fisker,
    • Valnøtter.

    Med en økning i GGT, anbefales det at du umiddelbart slutter å ta alkohol, justere dosen av medisiner som er tatt (bare i samsvar med legens anbefalinger). I tilfeller der et negativt analyseresultat er forårsaket av leverproblemer, vil normalisering av nivået hjelpe:

    • Urtepreparater (avkok av melististel, immortelle eller tablettform - Karsil, Silmarillion, Flamin);
    • Fosfolipider - Phosphogliv, Essentiale-preparater;
    • Vitaminer fra gruppe B, vitamin E.

    Hva er enzymet Gamma-glutamyltranspeptidase: normer, årsaker til økning og reduksjon

    En biokjemisk blodprøve hjelper til med å vurdere den funksjonelle tilstanden til organer og systemer i kroppen. For diagnosen er det viktig å vurdere tilstanden til forskjellige sporstoffer, inkludert enzymer. Gamma-glutamyltranspeptidase er et enzym av leverceller, gallekanaler, det er en katalysator for en rekke biokjemiske reaksjoner. GGTP-analyse er mest følsom for kolestase (galdeopphopning). Det er indikert når symptomer som:

    • tretthet, svakhet;
    • tap av Appetit;
    • kvalme og oppkast;
    • smerter i høyre hypokondrium;
    • misfarging av urin og avføring;
    • kløende hud, gulsott.

    Konsept og struktur

    Gamma-glutamyltranspeptidase (GGT, GGTP, Gamma-glutamyl transpeptidase - GGTP) er et enzym som er nødvendig for utveksling av aminosyrer. Det fungerer som en katalysator for overføring av gamma-glutamylrest fra gamma-glutamylprotein til et annet protein, aminosyre eller molekyl. GGTP er et heterodimerisk protein, dets underenheter er sammensatt av polypeptidkjeder. Det aktive senteret til enzymet ligger utenfor cellemebran.

    Gamma-glutamyltranspeptidase akkumuleres i:

    • Nyrene. Konsentrasjonen er 7000 ganger høyere enn i serum.
    • Leveren. 500 ganger mer enn myse.
    • Bukspyttkjertelen. Her er innholdet 650 ganger høyere enn i blodserum.

    I små mengder, tilstedeværelsen av enzymet i:

    • tarmene;
    • milten;
    • lunger;
    • hjertemuskelen;
    • muskulatur av skjelettet;
    • prostata.

    I celler er enzymet lokalisert i membraner, lysosomer og cytoplasma.

    GGTP - er en markør for hepatotoksisitet. Ved leversykdom stiger nivået av enzymet i blodet i 90% av tilfellene. Dessuten er gamma-glutamyltranspeptidase mer følsom for patologier i lever og galleveier enn alkalisk fosfatase og aspartataminotransferase (ALT eller AST).

    Indikasjoner for analyse

    Analyse for GGT brukes til å bekrefte sykdommen i gallekanalene, leveren. Mest effektiv for mistenkte neoplasmer i bukspyttkjertelen, tilstedeværelsen av steiner i gallegangene og blokkering av galleveiene.

    Analysen er viktig for å overvåke effektiviteten av behandling av alkoholisk hepatitt, alkoholisme. GGT hjelper også med å overvåke tilstanden til pasienter med sykdommer forbundet med en økning i enzymet, evaluere effektiviteten av terapien.

    Analyse for GGT er vist å ta:

    • Under rutinemessige inspeksjoner.
    • Som forberedelse til operasjonen.
    • For å evaluere leverfunksjon - innenfor rammen av standard leverprøver.
    • For å oppdage stagnasjon av galle.
    • Ved mistanke om alkoholisme.
    • Under behandlingen av alkoholisme, alkoholisk hepatitt.
    • Mens du tar medisiner som forårsaker kolestase.

    norm

    For analyse brukes venøst ​​blod. Normale verdier avhenger av kjønn og alder på pasientene. Det bestemte nivået av enzymet avhenger av utstyret som brukes, måleenhetene (U / L, U / ml eller μkat / l, med 1 U / L = 0,0167 μkat / l). Derfor, når du tolker resultatene, er det nødvendig å fokusere på data fra ett laboratorium.

    AlderMenn, U / LKvinner, U / L
    nyfødteFrem til 185Frem til 185
    5 dager i livet - 6 måneder.Frem til 202Frem til 202
    6 måneder - 1 årOpp til 34Opp til 34
    1-3 årFør 18Før 18
    3-6 år gammelOpp til 22Opp til 22
    6-12 år gammelOpp til 16Opp til 16
    12-17 år gammelOpp til 45Opp til 33
    Fra 18 år10-716-42

    En høy konsentrasjon av enzymet hos nyfødte forklares med at kilden i kroppen i løpet av de første dagene av livet er morkaken, og først da begynner Gamma glutamyl transpeptidase å produseres i leveren.

    Graden av GGT i blodet avhenger også av rase - representanter for Negroid-løpet har indikatorer som er omtrent 2 ganger høyere enn europeere.

    Hos voksne menn, som det fremgår av tabellen, er konsentrasjonen av GGT høyere enn hos kvinner. Dette skyldes tilstedeværelsen av enzymet i prostatakjertelen, som hjelper i diagnosen prostatitt, kreft i kjertelen - i disse tilfellene øker nivået av GGT kraftig.

    Hos gravide kvinner skiller indikatorene seg fra referanseverdiene i forskjellige stadier av graviditeten:

    • I første trimester (opptil 13 uker) er enzymnivået 0-17 U / L.
    • I andre trimester (uke 14-26) når nivået av GGT 33 enheter / l.
    • I tredje trimester (27-39 uker) overskrider indikatoren ikke 32 U / L.

    Årsaker til økningen

    En økning i GGT-nivå er avgjørende for diagnostisering av sykdommer i lever- og lungekanalen og leveren. Enzymet er mest følsomt for skade på hepatocytter (leverceller) sammenlignet med alkalisk fosfatase, glutamatdehydrogenase, AST, ALT, etc. En økning i konsentrasjonen av Gamma-glutamyl transpeptidase indikerer hepatotoksisitet: i 90% av leverpatologiene øker enzymnivået.

    GGT er spesielt følsom for effekten av alkohol. Dette faktum brukes til å vurdere effektiviteten av behandlingen for alkoholisme - en måned etter behandlingen reduseres nivået av GGT med halvparten.

    De viktigste årsakene til økningen er:

    • Skader på galleveiene. GGT er en markør for gallestase. En økning i indikatoren kan indikere tilstedeværelse av steiner i kanalene, arr etter operasjoner, neoplasmer, kreft i bukspyttkjertelen..
    • Leverskader, inkludert akutt og kronisk hepatitt.
    • Alkoholisme - i 60% av tilfellene, siden hos 30% alkoholikere er enzymnivået normalt.
    • Mononukleose er smittsom. Utviklingen av patologi involverer leveren i prosessen. Infeksjonen er ledsaget av slike symptomer: feber, lymfeknuter øker, svelget blir betent.
    • Ekstremt høye GGT-verdier sammen med alkalisk fosfatase er et tegn på autoimmun skade på gallegangene. Sjeldne sykdommer forbundet med dem er primær skleroserende kolangitt og primær galle-skrumplever..

    Ved akutt hepatitt stiger nivået av GGT tidligere enn verdiene til ALT og AST (aminotransferaser). Videre, på toppen av sykdommen, er konsentrasjonen av Gamma-glutamyltranspeptidase flere ganger lavere, men går sakte tilbake til det normale. Det hjelper til med å kontrollere helingsprosessen..

    Det er andre årsaker til økningen i GGT. Disse inkluderer:

    • pankreatitt.
    • Brystkreft.
    • Prostatakreft.
    • lupus erythematosus.
    • Hjertefeil.
    • Hjerteinfarkt - i dette tilfellet noteres en økning i konsentrasjonen 4 dager etter sykdomsdebut.
    • diabetes.
    • hypertyreose.
    • Revmatoid artritt, lungesykdom.

    Inntak av visse typer medisiner kan øke nivået av Gamma-glutamyltranspeptidase i blodet. Antibiotika, statiner, paracetamol, aspirin, antidepressiva, p-piller, testosteron og en rekke andre stoffer kan øke innholdet av GGT.

    Blant de fysiologiske årsakene forårsaker en økning i nivået av enzymet overvekt..

    Hvis analysen viser en økning i GGT, er det nødvendig å identifisere årsaken til dens vekst. Basert på undersøkelsen stiller legen en diagnose og foreskriver nødvendig behandling.

    Årsaker til nedgangen

    Hos pasienter med alkoholisme observeres en reduksjon i GGT-nivåer en måned etter behandlingsstart - avholdenhet fra alkohol. Dette skyldes mangelen på et stimulerende middel (etanol) med forbedret syntese av enzymet av leverceller.

    Årsakene til nedgangen i Gamma-glutamyltranspeptidase er også:

    • hypotyreose.
    • Tar hormonelle prevensjonsmidler, clofibrat.

    Regelmessig fysisk aktivitet, et strengt vegetarisk kosthold kan bidra til å redusere konsentrasjonen av GGT..

    Det Er Viktig Å Være Klar Over Vaskulitt