Blodprøve gamma rt økte hva betyr det

Ulike forbindelser inne i cellene i kroppen vår kan hjelpe til med diagnostisering av en rekke sykdommer. Så for eksempel kan leverenzymer indikere en patologi av dette organet hvis nivået i blodet stiger. En av dem er gamma glutamyl transferase (GGTP). Det vil bli sortert ut hva slags enzym det er, under hvilke spesifikke forhold det stiger i blodet.

GGTP - hva slags forbindelse er det og hvilke funksjoner utfører den

Hva er det?

GGTP står for gamma-glutamyl transpeptidase. Noen ganger kaller denne indikatoren GGT, som står for gamma-glutamyltransferase. Begge disse navnene refererer til det samme enzymet..

Hvor blir dannet

Dette enzymet kan finnes i tubulene i nyrenephronen, i epitelet som fôrer gallegangene. Det meste finnes i leverceller. Derfor, når disse vevene er skadet, kommer enzymet inn i blodomløpet, noe som gjør at legen kan diagnostisere en funksjonssvikt i disse organene.

Hovedfunksjoner

Glutamyltransferase er et enzym. Og enzymets viktigste rolle er å katalysere en reaksjon. GGT katalyserer reaksjonene ved glutamyloverføring til en aminosyre eller andre forbindelser. Denne overføringen er veldig viktig i utvekslingen av aminosyrer: enzymet fremmer deres transport, for eksempel gjennom tarmveggen fra dens lumen til blodet.

Når det utnevnes en analyse for å bestemme GGTP?

Definisjonen av denne typen transferase kan tilordnes separat eller i kombinasjon med andre leverenzymer, for eksempel aspartataminotransferase eller alaninaminotransferase for diagnostisering av tilstanden i levervekten..

Glutamyltranspeptidaseaktiviteten øker også når giftige stoffer, som visse medikamenter eller alkohol, blir utsatt for leveren. Så du kan forstå om leverskader var forårsaket av alkohol eller ikke..

Glutamyltransferase finnes ikke i bein. Følgelig vil ikke benvevs patologi påvirke nivået av GGT. Dette lar deg søke etter grunner til å øke et annet enzym - alkalisk fosfatase.

GGT lar deg også vurdere nyrenes tilstand, og i tilfelle brudd på arbeidet deres, vil dette enzymet fortelle legen om det.

Dermed muliggjør gamma-glutamyltransferase den differensielle diagnosen tilstander som forårsaker nedsatt leverfunksjon, patologi i nyrene og galleveiene.

Analyse forberedelse

Hvordan forberede?

Definisjonen av gamma-glutamyltransferase refererer til en rekke biokjemiske blodprøver. For å få nøyaktig informasjon om GGT i kroppen, må pasienten på riktig måte forberede seg til bloddonasjon.

Forberedelsesreglene er veldig enkle:

  • for biokjemiske studier, bør blod tas på tom mage, det vil si etter nattlig faste i 10 til 12 timer. Så du kan være sikker på at blodet vil være egnet for forskning og vil gjenspeile det nøyaktige innholdet av testparameteren i blodet;
  • Det anbefales å ikke røyke i flere timer før blodprøvetaking;
  • emosjonelle opplevelser dagen før analysen kan påvirke nøyaktigheten av resultatene fra studien;
  • trening og annen fysisk overbelastning av kroppen bør avskaffes. De kan også påvirke sluttresultatet;
  • Hvis medisiner er foreskrevet til pasienten, må du oppsøke lege - kan de påvirke nivået av enzymet i blodet? Pasienten skal ikke avlyse noe og utnevne seg!

Hvor du skal gi opp?

Blodprøvetaking for å bestemme nivået av glutamyltransferase skjer på et spesialkontor på en medisinsk institusjon. Oftest er det en klinikk på bostedet. Denne enkle analysen kan utføres i private medisinske organisasjoner..

Når du kontakter klinikken på bostedet, er bestemmelsen av gamma-glutamyltransferase gratis for pasienter med en obligatorisk medisinsk forsikring. Hvis pasienten uttrykte et ønske om å donere blod for å bestemme nivået av dette enzymet i et privat medisinsk senter, vil prisen for denne analysen være rundt 150 - 300 rubler.

Husk at en ekstra avgift belastes for selve blodprøvetakingsprosedyren. I gjennomsnitt vil dette være omtrent 150 - 300 rubler, avhengig av regionen.

Dekryptering av analyse

Norm for menn og kvinner

Grensene for normale gamma-glutamyltransferase-nivåer er forskjellige for menn og kvinner. Normen for kvinner er ikke mer enn 30 enheter per liter (U / L), og for menn - ikke mer enn 50.

I tillegg ble det kun gitt indikative standarder for GSTP. I hvert laboratorium kan standardene variere avhengig av hvilke testsystemer som brukes for å bestemme aktiviteten til dette enzymet i blodserum..

Gitt dette gjøres en studie av nivået av GGT i dynamikk best i det samme kliniske diagnostiske laboratoriet.

Normer hos barn

Normale nivåer av GGT hos barn er høyere enn hos voksne og varierer avhengig av barnets alder.

I den første uken av et barns liv bør nivået av GGTP ikke overstige 180 enheter per liter. Da kan enzymnivået øke, men ikke mer enn 200 enheter i løpet av første halvår.

Ved det første året av et barns liv reduseres nivået av gamma-glutamyltransferase til et nivå på ikke mer enn 35 enheter per liter. Under veksten og livet til barnet endrer nivået av glutamyltransferase ikke mye. Fra rundt tolvårsalderen blir normale enzymnivåer de samme som for en voksen.

Avvik fra normen

En endring i aktiviteten til enzymet glutamyltransferase mer enn referanseverdier indikerer patologi. I tillegg til sykdommer, kan medisiner føre til et avvik fra normen, men mer om det senere.

Noe som fører til en økning i GGTP?

Det er en rekke patologier i leveren og galleveiene, som er ledsaget av økt aktivitet av gamma-glutamyl transpeptidase. Disse inkluderer:

  • brudd på utstrømningen av galle gjennom kanalene på grunn av blokkering av lumen av en stein, en svulst, som forårsaker utvikling av mekanisk (hindrende eller subhepatisk) gulsott hos en pasient;
  • leverskade forårsaket av virkningen av alkohol, for eksempel hepatitt;
  • erstatning av bindevev, som kalles skrumplever;
  • pankreatitt - betennelse i bukspyttkjertelen;
  • autoimmun skade på leveren og gallegangene;
  • diabetes;
  • leverskade med smittsom mononukleose;
  • leverkreft;
  • nyrepatologi, for eksempel kronisk nyresvikt.

Rettelsesmetoder

Bare en lege kan korrigere nivåer av gamma-glutamyltransferase. Etter å ha analysert dataene til andre resultater av analysen, vil han kunne finne ut årsaken og utføre kompetent behandling av den primære sykdommen. Etter helbredelse vil nivået på enzymet gå tilbake til normalt..

For eksempel, hvis den økte aktiviteten til GGT er forårsaket av høyt alkoholforbruk, vil enzymnivået gå tilbake til normalt når du stopper bruken..

Hva kan føre til bedre resultater foruten sykdommer?

Unormale resultater av gamma-glutamyltransferase-nivåer kan være et resultat av alkoholmisbruk før dagen til en blodprøve. Det ble også nevnt tidligere at noen medikamenter kan påvirke resultatene av studien og overdrive de virkelige verdiene..

Disse medisinene inkluderer:

  • barbiturater,
  • statiner - en gruppe medikamenter som brukes til å senke kolesterolet i blodet;
  • antidepressiva;
  • noen typer antibiotika;
  • p-piller og noen andre hormonelle medisiner;
  • Aspirin, Paracetamol.

Det er også bemerket det faktum at hos overvektige individer nivået av enzymet vil være høyere enn normalt. Dette bør legen ta hensyn til når han tolker resultatene av studien..

Konklusjon

Gamma-glutamyltransferase er en viktig diagnostisk indikator. Dette enzymet lar deg diagnostisere lesjoner i leveren, galleveiene og nyrefunksjonen. GGT er en sensitiv indikator, derfor er det viktig å forberede deg på riktig måte.

Vi gjorde mye for at du kan lese denne artikkelen, og vi vil være glad for tilbakemeldingene dine i form av en vurdering. Forfatteren vil være glad for å se at du var interessert i dette materialet. takke!

GGT i en biokjemisk blodprøve

De siste årene har gamma glutamyltransferase eller forkortet GGT fått popularitet i diagnosen sykdommer som gulsott, kolangitt, kolecystitt. I henhold til påliteligheten av resultatene av diagnosen GGT, er det å foretrekke fremfor indikatorer på slike enzymer som ALT og AST.

Gitt leverens funksjonelle betydning, uten en klar operasjon, forblir kroppen tilnærmet ubeskyttet i tilfelle feil i arbeidet. Og de siste årene har det blitt klart at følsomheten for gallegang i selve leveren, så vel som i gallegangene er høyere nøyaktig i GGT.

Av denne grunn ble GGT-analyse inkludert i det obligatoriske settet med leverprøver. For øvrig bestemmes også kronisk alkoholisme ved bruk av samme test..

Hva er GGT i en blodprøve

I tarmens celler, hjerne, hjerte, milt og prostata observeres lav aktivitet av gamma-glutamyltranseptidase (forkortet GGTP eller GGT). Hos en sunn person oppdages GGT i blodceller i en minimal mengde, dette skyldes den normale prosessen med å oppdatere cellene i kroppen. En økning i mengden av dette enzymet i blodomløpet er imidlertid alltid assosiert med patologiske prosesser og indikerer ødeleggelse av cellene det er inne i.

Gitt den høye konsentrasjonen av GGT i vevene i nyrene, leveren og bukspyttkjertelen, regnes det som en følsom markør for sykdommer i disse organene. Den raskeste og lyseste gamma glutamyltransferasen reagerer på skader på lever-gallersystemet.

GGT-funksjoner

Gamma glutamyltransferase deltar i prosessene:

  • aminosyremetabolisme;
  • metabolisme av inflammatoriske responsformidlere.

Til tross for at konsentrasjonen av GGT i nyreepitel er høyere enn i leveren, er serumkonsentrasjonene (bestemt i blodet) hovedsakelig av leveropprinnelse. Det meste av den ødelagte GGT i nyrene skilles ut i urinen.

I hvilke tilfeller er analysen foreskrevet for GGTP

Studien av ytelsen til dette enzymet i serum er informativ når:

  • overvåking av alkoholisme;
  • diagnose av sykdommer i leveren, galleblæren og gallegangene;
  • overvåking av ondartede svulster, deres tilbakefall og spredning av metastaser;
  • diagnose av årsakene til økt alkalisk fosfatase;
  • overvåking effektiviteten av behandlingen av sykdommer i lever-og gallesystemet;
  • utseendet på klager som indikerer skade på leveren, galleblæren eller kanalene (mørk urin, lettende avføring, kløe i huden, gulsott, etc.);
  • diagnose av ekstrahepatiske patologier, i kombinasjon med andre studier.

Les også om emnet.

Årsaker til økt GGT i blodet

Ved alvorlig stagnasjon av galle (kolestase) begynner nivået av gamma-glutamyl transpeptidase å øke tidligere enn alkalisk fosfatase. Ved tolkning av analysene må det imidlertid tas med i betraktningen at GGT kan reagere kraftig på eventuelle sykdommer i lever-systemet. Derfor bør en økning i GGT alltid være korrelert med aktiviteten til AlAT og AsAT.

Hos gulsott er forholdet mellom GGT og ALAT en direkte indikator på en økning i gallestase relativt til ødeleggelse av cellestrukturer.

Graden av økning i gammaglutamyltransferase vil være direkte avhengig av dosen og frekvensen av drikking. Derfor brukes GGT ofte i kontrollen av alkoholuttak..

I tillegg til leverskade som følge av alkohol, reagerer dette enzymet også på utviklingen av medikamentell hepatitt når du tar hepatotoksiske medikamenter (tetracykliner, sulfonamider, ikke-steroide antiinflammatoriske medikamenter, diuretika, etc.).

Den neste grunnen til økningen i GGT er primære ondartede svulster i lever- og gallesystemet eller levermetastaser. Godartede neoplasmer gir som regel ikke slike endringer i analysene, siden veksten av dem ikke er ledsaget av ødeleggelse av sunt vev og alvorlig rus. Unntaket er svulster, noe som fører til hindring (blokkering) av gallegangene og bidrar til utvikling av obstruktiv gulsott.

Blant andre "galle" årsaker til vekst av gamma GT i analysene skilles gallesteinsykdom, akutt og kronisk kolecystitt..

Gamma glutamyltransferase reagerer også på kreft i bukspyttkjertelen og prostata..

I tillegg til giftige (medikamenter, alkohol) leverskader og ondartede svulster, øker GGT med:

  • akutt og kronisk viral hepatitt;
  • ikke-smittsom hepatitt;
  • smittsom mononukleose;
  • fet hepatose;
  • levercirrhose;
  • alvorlig forgiftning.

I tillegg til sykdommer i lever-og gallesystemet, kan GGT øke med skade på andre organer og bruk av visse medisiner, spesielt er dette enzymet økt med:

  • hjerteinfarkt (her er årsaken ikke bare hjerteinfarkt skade, men også prosessen med aktivering av utvinningsprosesser som oppstår i hjertemuskelen og leverparenkym, i denne forbindelse skjer den maksimale økningen i GGT i den tredje uken etter et hjerteinfarkt);
  • nyreskade (kronisk glomerulonefritt og amyloidose);
  • å ta antiepileptika og anti-tuberkulosemedisiner;
  • leddgikt;
  • hyperteriosis;
  • fedme;
  • diabetes.

GGT i en blodprøve - forårsaker en økning eller reduksjon. Hvordan går glutamyltransferasetest?

Gamma-glutamyltranspeptidase (GGT, GGTP) er en av indikatorene i studier av leveren, som er karakterisert som et proteinenzym involvert i metabolismen av aminosyrer.

Konsentrasjonen av dette enzymet oppstår hovedsakelig i levercellene, nyrene og bukspyttkjertelen. Det er observert en lavere konsentrasjon i hjernen, hjertehulen, tarmen og milten.

Denne indikatoren er signifikant i diagnosen leverdysfunksjon. Det samme navnet er gamma-glutamattransferase, og bestemmelsen finner sted i en biokjemisk blodprøve, eller med leverprøver.

Hva er glutamintransferase??

Glutamyltransferase (ggt) deltar i komplekse biokjemiske prosesser, og er en katalysator i transport og metabolisme av aminosyrer med kroppsceller.

Lokaliseringen av dette protein-enzymet er lokalisert direkte i cellen, i membranen, lysosom og cytoplasma..

Når en celle deformeres, kommer den inn i blodomløpet. Lite økninger i indikatoren er normal, siden kroppen hele tiden behandler døden av gamle celler, og deres erstatning med nye. Patologisk er en tilstand der et stort antall celler dør, men mye mindre blir gjenopprettet..

I det endelige testresultatet kan Y glutamyl transpeptidases (GGT) og gamma glutamintransferase (GGTP) fikses. De har en liten forskjell:

Dette membranbindende enzymet er involvert i metabolismen av aminosyrer. Den største konsentrasjonen er i milten, bukspyttkjertelen, levervevet og nyrene. I alle disse organene ligger den i den ytre membranen.Det er en aktiv deltaker i dannelsen av nye proteinmolekyler, katalyserer biokjemiske reaksjoner og er en mer betydelig test i diagnosen leversykdommer. GGTP indikerer tilstedeværelsen av kolestase, og består av en biokjemisk blodprøve kalt leverprøver, sammen med enzymer som ALT, AST og alkalisk fosfatase, samt bilirubin.

I nærvær av patologiske tilstander akselereres prosessen med celledeformasjon betydelig, noe som fører til en plutselig økning i GGT i blodplasma. Det er han som reagerer raskere på skader på leverceller og er en mer følsom indikator. Det hjelper med å diagnostisere hepatitt veldig effektivt, selv før endringer i andre blodverdier og eksterne symptomer.

En indikator som glutamyl transpeptidase er også veldig følsom for effekten av alkohol, og brukes til å justere behandlingen for alkoholisme..

Når analyse er planlagt?

Henvisning til analysen skjer med mistanke om patologiske lidelser i leveren, samt med alkoholisme. Derfor er GGT-indikatoren viktig for en narkolog.

Retning for analyse av leverenzymer oppstår med mistanke om patologiske lidelser i leveren.

I følgende tilfeller er en studie av leverprøver foreskrevet:

  • Mistenkt leverdød på grunn av alkoholeksponering,
  • Mistenkt hepatitt,
  • For diagnose av patologiske lesjoner i leveren,
  • Hvis det er mistanke om kreft i prostata eller bukspyttkjertelen,
  • For å overvåke effektiviteten av terapi i behandlingen av alkoholisme,
  • Ved klager på smerter i høyre mage,
  • Kvalme oppkast,
  • Konstant tretthet,
  • gulsott,
  • Før valgfri kirurgi,
  • Med rutinemessige medisinske undersøkelser.

Hva er indikatorene for GGT-normen?

En måned senere, etter den siste bruken av alkohol, er dette tallet halvert.

Normen for glutamyltransperidase varierer avhengig av alderskategori, kjønn og til og med rase. Legen bør vurdere dette når han studerer resultatene av analysen..

Normene til voksne varierer fra seks til sytti enheter per liter, gitt at kvinner har et betydelig lavere nivå enn menn.

Og hos barn kan GGTF nå merker på 185 enheter / l, og i en alder av opptil seks måneder kan økningen være opp til 200 enheter / l.

Når det gjelder spedbarn, kan gamma-glutamyltransferase økes, og dette betyr at etter en fødsel, i flere dager, blir dette enzymet praktisk talt ikke syntetisert av leveren, og hovedleverandøren er morkaken.

Faktum! Dessuten registreres høyere nivåer av GGT hos personer med mørk hudfarge. Forskjellen mellom indikatorer mellom svarte og europeere kan være nesten 2 ganger.

AlderskategoriNormen hos menn ved en temperatur på 37 grader Celsius (Enhet / L)Normen hos kvinner ved en temperatur på 37 grader Celsius (Enhet / L)
Barn opp til 5 dager i livet& lt, 185& lt, 185
5 dager til 6 måneder& lt, 204& lt, 204
6 til 12 måneder& lt, 34& lt, 34
13 år& lt, 18& lt, 18
36 år& lt, 23& lt, 23
6 til 12 år gammel& lt, 17& lt, 17
12-17 år gammel& lt, 45& lt, 33
Mer enn 17 år& lt, 49& lt, 32

Resultatene fra tabellen over sporer tydelig det økte nivået av blodproteinemetting hos menn over tolv år, sammenlignbart med kvinner i samme alder.

Denne forskjellen skyldes akkumulering av GGT-enzymet i prostata. Dette lar deg diagnostisere prostatitt og andre patologiske tilstander i denne kjertelen, og manifesterer seg i høye nivåer av GGT i blodbiokjemi.

Det er også separate normer for kvinner som føder barn, de er listet opp i tabellen nedenfor.

SvangerskapsalderNorm (Enhet / L)
1-3 måneder0-17
3 - 6 mnd& lt, 33
6 - 9 mnd& lt, 32

Ytelsen til forskjellige laboratorier kan variere, derfor bør normen for et bestemt laboratorium anerkjennes på analysestedet. Men i de fleste tilfeller vil et brudd på resultatet bli fremhevet i rødt (allment akseptert laboratorieregel) for å tydelig skille seg fra andre indikatorer.

Gamma GT forhøyede årsaker?

Faktorene som påvirker økningen i GGT er ganske mange sykdommer forbundet med lidelser i leveren.

Årsaken til økningen kan være en av følgende:

  • Levervevets død under påvirkning av alkoholgifter,
  • Leverkreft,
  • Kronisk hepatitt,
  • gulsott,
  • kolecystitt,
  • Giftig leverskade,
  • Levervevsdød på grunn av hepatitt,
  • Akutt viral hepatitt,
  • diabetes,
  • Patologiske tilstander i lungene,
  • gikt,
  • lupus erythematosus,
  • Fet hepatose,
  • Stråling av leveren,
  • gallestein,
  • Ondartede svulster som metastaserer til leveren,
  • Død av hjertemuskelvev (høy GGT er notert etter den fjerde dagen av den patologiske tilstanden, og maksimale verdier er nådd etter et par uker). Årsaken til økningen er utvinningsprosessene til myocardium og leverparenkym,
  • Alkoholavhengighet,
  • Medisiner for behandling av tuberkulose (Rifampicin), epilepsi (Phenobarbital, Phenytoin), hormonelle prevensjonsmidler, antikonvulsiva, individuelle antidepressiva, steroider, revmatisme medisiner.

For nøyaktig diagnose er det i de fleste tilfeller foreskrevet ytterligere maskinvarestudier av kroppen.

Hvorfor indikatorene faller?

En reduksjon i en slik indikator som glutaminaminotransferase er en sjelden forekomst. Og det skyldes en av tre grunner:

  • Hypotyreoidisme er en patologisk tilstand i skjoldbruskkjertelen der den produserer en utilstrekkelig mengde hormoner - tyroksin og triiodotyronin - som fører til en funksjonsfeil i de metabolske prosessene i kroppen,
  • Bruk av visse medisiner,
  • GGT senkes hos pasienter som er under behandling for alkoholavhengighet etter en måneds behandling.

Hvordan er GGT-analyse?

Studien av GGT er inkludert i den biokjemiske analysen av blod og er inkludert i gruppen av leverprøver. For å bestemme bruken av humant biologisk materiale (blod), som gis til tom mage, siden forbruk av mat øker aktiviteten til enzymer, noe som vil føre til falske resultater.

Blodprøvetaking kommer fra en blodåre.

Det er veldig viktig å observere alle forberedelsestiltak før du gjør en blodprøve, slik at du ikke trenger å gå gjennom den igjen.

Nivået av GGT er fast ved forskjellige temperaturer i inkubasjonsprøven og ved forskjellige metoder. Valg av metode og temperatur som brukes, avhenger direkte av laboratoriet som pasienten testes og utstyret installeres i.

Som et resultat av analysen, ved siden av GGT-indikatoren, noteres temperaturen som studien ble gjennomført. Så dekryptering av analysen er kun underlagt en erfaren lege, siden det i tillegg til temperaturen og metoden for undersøkelse er nødvendig å ta hensyn til kjønn, alder og også pasientens løp.

Hvilke tiltak du må følge når du forbereder deg?

For å unngå falske indikatorer i den endelige resultattabellen, anbefales det at forberedelsestiltakene følges. Ved å overholde reglene oppført nedenfor, vil resultatene være de mest pålitelige, noe som vil bidra til å korrekt diagnostisere eller tilbakevise sykdommen.

De viktigste anbefalingene for forberedelse er:

  • Blod blir gitt til tom mage. For å unngå avvik i blodtall provosert av aktivering av enzymer på grunn av matinntak. Bruken av produkter er begrenset til minst åtte timer (fortrinnsvis mer enn ti) før blodprøvetiden. Det er grunnen til at analysen overgir seg om morgenen, fordi om natten en person ikke vil føle sult. Det er også forbudt å drikke noe, inkludert vanlig drikkevann.,
  • Nekter å spise fet, sterkt saltet, krydret, overkokt, tung for kroppsmat på minst tjuefire timer (helst 48 timer). Slike produkter virker for sterkt på enzymer og øker hastigheten betydelig,
  • For å slutte å spille idrett og maksimalt unngå sterk fysisk anstrengelse, anbefales det i to dager, siden fysiske effekter på kroppen også påvirker de endelige resultatene,
  • Et besøk i badstuen, badekar, varmt bad dagen før, kan føre til svingninger i normale priser. Unngå å besøke steder der kroppen er utsatt for termiske effekter.,
  • Begrens inntaket av alkohol og sigaretter minst en dag før den kommende analysen,
  • Suspendere bruken av medisiner minst to dager før analysen. Forberedelser av visse grupper kan påvirke utførelsen av en biokjemisk blodprøve. Hvis det ikke er mulig å stoppe bruken av medisiner, er det nødvendig å informere den behandlende legen om bruken av medisiner. Legen vil gjøre en justering av resultatene, i samsvar med virkningen av et bestemt legemiddel på menneskelig blod,
  • Kom for bloddonasjon på forhånd i 10-15 minutter. Dette er nødvendig slik at kroppen roer seg, pustebesværet passerer, og kroppen akklimatiserer seg til temperaturforholdene i rommet (spesielt etter en kald gate).

Faktum! Hvis du opplever alvorlig sult, er det bedre å ta matprodukter med deg og tilfredsstille sulten umiddelbart etter blodprøvetaking.

Hva kan påvirke resultatene?

I tillegg til leversykdommer kan følgende faktorer føre til et normalt resultat, noe som kan føre til en falsk indikator. Disse inkluderer:

  • Langvarig bruk av askorbinsyre kan undervurdere resultatet av GGT betydelig,
  • Et økt nivå av GGT provoseres av antibiotika, antidepressiva, p-piller, aspirin, paracetamol, testosteron og visse typer medisiner.,
  • Overdreven vekt.

Faktum! Ved avkoding av analysen er det også viktig å ta hensyn til andre indikatorer i den biokjemiske analysen av blod (lipase, LDH, bilirubin, ALT, AST, etc.), siden nesten alle avvik fra GGT er ledsaget av et brudd på nivåene av andre enzymer. ALT og AST er forhøyet, deretter bekreftes patologien.

Hvordan redusere GGT?

For å senke GGT-indeksen, er det nødvendig å kurere den innledende patologien, som forårsaket en slik

Ved behandling av alkoholisme reduseres GGT-hastigheten etter en måned.

stat. Når kurert av en primær sykdom, kan indikatorer normaliseres raskt nok..

Forebyggende tiltak bør også treffes for å forhindre et bredt spekter av sykdommer. Disse inkluderer:

  • Rydd opp i den daglige rutinen, og gi tid til en god hvile og søvn,
  • Unngå anstrengende trening,
  • Kvitt deg med dårlige vaner. Giftstoffer som leveres med alkohol og sigaretter er skadelige for kroppen.,
  • Spis ordentlig. Kostholdet må være balansert, slik at kroppen får alle nødvendige næringsstoffer og sporstoffer,
  • Oppretthold kroppen ved normal temperatur. Kroppen skal ikke være for kald eller oppvarmet,
  • Unngå stressende situasjoner. Eliminer sterkt emosjonelt stress (både positivt og negativt), konstant stress,
  • Det anbefales å gå inn for sport, opprettholde en aktiv livsstil og også tildele minst en time om dagen til fotturer,
  • Ta en blodprøve en gang i året og bli undersøkt. Dette gjøres for tidlig diagnose av mulige sykdommer..

Overholdelse av disse enkle, men effektive reglene vil beskytte mot de fleste sykdommer og forbedre en persons tilstand..

Konklusjon

Ulike laboratorier forsker på forskjellige måter, avhengig av utstyr og forskningsmetode..

Diagnostikk er ikke bare basert på de biokjemiske parametrene til GGT. For ytterligere diagnose tas indikatorer for andre blodenzymer i betraktning, samt ytterligere maskinvarestudier.

Du kan prøve å tyde den generelle blodprøven hjemme, men husk at det avhenger av mange faktorer, så det er best å overlate den til en kvalifisert lege.

Hvis du oppdager de minste sykdomssymptomene, må du kontakte sykehuset for undersøkelse og effektiv behandling..

Ikke selvmedisiner og vær sunn!

Det Er Viktig Å Være Klar Over Vaskulitt